DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubx and CG34367

DIOPT Version :10

Sequence 1:NP_536752.1 Gene:Ubx / 42034 FlyBaseID:FBgn0003944 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_001097140.1 Gene:CG34367 / 5740879 FlyBaseID:FBgn0085396 Length:420 Species:Drosophila melanogaster


Alignment Length:109 Identity:36/109 - (33%)
Similarity:54/109 - (49%) Gaps:10/109 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   248 ECPEDPTKSKIRSD--LTQYGGISTD--MGKRYSESLAGSLLPDWLGTNGLRRRGRQTYTRYQTL 308
            ||.||....|:..|  |.....:|.:  ..:.:.:.|..||:      |..:||.|..:|..|..
  Fly   147 ECTEDSNTPKLAPDKPLLPEECVSPEPSRNREHCDPLDTSLV------NTKQRRSRTNFTLDQLN 205

  Fly   309 ELEKEFHTNHYLTRRRRIEMAHALCLTERQIKIWFQNRRMKLKK 352
            |||:.|...||.....|.|::..|.|:|.::::||||||.|.:|
  Fly   206 ELERLFEETHYPDAFMREELSQRLGLSEARVQVWFQNRRAKCRK 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UbxNP_536752.1 Homeodomain 296..352 CDD:459649 23/55 (42%)
CG34367NP_001097140.1 Homeodomain 193..249 CDD:459649 23/55 (42%)
OAR 392..410 CDD:461067
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.