DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubx and gsx2

DIOPT Version :9

Sequence 1:NP_536752.1 Gene:Ubx / 42034 FlyBaseID:FBgn0003944 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_001020683.1 Gene:gsx2 / 561076 ZFINID:ZDB-GENE-041001-114 Length:242 Species:Danio rerio


Alignment Length:215 Identity:69/215 - (32%)
Similarity:92/215 - (42%) Gaps:53/215 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   143 GQNNPAGGMPVRPSACTPDSRVGGY----LDTSGGSPVSHRGGSAGGNVSVSGGNGNAGGVQSGV 203
            |.::| |.|.|....| |..:.|.:    |..|     ||.....||...:.|....||      
Zfish    33 GMHSP-GVMSVTAPIC-PSRKTGTFCVCPLCVS-----SHIHSPRGGIPLLKGQGFTAG------ 84

  Fly   204 GVAGAGTAWNANCTISGAAAQTAAASSLHQASNHTFYPWMAIAGECPEDPTKSKIRSDLTQYGGI 268
                           ..|..|..|    ||.|....:|....|..|  .||...: :|..:|..:
Zfish    85 ---------------DAAFCQRMA----HQQSPALAHPGHGHAPVC--TPTSFSV-TDPRRYHCL 127

  Fly   269 STDMGKRYSESLAGSLLPDWLGTNGLRRRGRQTYTRYQTLELEKEFHTNHYLTRRRRIEMAHALC 333
            |  :|...:..:          .||  :|.|..:|..|.||||:||.:|.||:|.||||:|..|.
Zfish   128 S--LGASDNSHI----------QNG--KRMRTAFTSTQLLELEREFSSNMYLSRLRRIEIATYLN 178

  Fly   334 LTERQIKIWFQNRRMKLKKE 353
            |:|:|:||||||||:|.|||
Zfish   179 LSEKQVKIWFQNRRVKHKKE 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UbxNP_536752.1 Homeobox 299..352 CDD:395001 31/52 (60%)
gsx2NP_001020683.1 COG5576 <132..242 CDD:227863 37/79 (47%)
Homeobox 144..196 CDD:278475 31/51 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.