DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubx and hoxb3

DIOPT Version :9

Sequence 1:NP_536752.1 Gene:Ubx / 42034 FlyBaseID:FBgn0003944 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_001015971.1 Gene:hoxb3 / 548725 XenbaseID:XB-GENE-482576 Length:386 Species:Xenopus tropicalis


Alignment Length:248 Identity:83/248 - (33%)
Similarity:107/248 - (43%) Gaps:57/248 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   141 ANGQNNPA--GGMPVRPSACTPDSRVGGYLDTSGGSPV-SHRG-------------GSAGGNVSV 189
            |:..:||.  ||.|.:..:.       ||.......|. ||..             |.:|..|..
 Frog     4 ASYYDNPTLFGGYPYQAGSL-------GYEGPQQSFPTSSHMDNEFQRSSCSLQSLGHSGPLVKA 61

  Fly   190 SGGNG-----NAGGVQSGVGVAGAGTAWNANCTISGAA------AQTAAASSLHQASNHTFYPWM 243
            ...||     |....||......|..:.|.|.:.|.|:      |::.|:.|  .||...| |||
 Frog    62 KNLNGSCMRPNLSSEQSQPLSPTANPSSNTNSSSSQASLSKPSPAKSQASGS--PASKQIF-PWM 123

  Fly   244 AIAGECPEDPTKSKIRSDLTQYGGISTDMGKRYSESLAGSLLPDWLGTNGLRRRGRQTYTRYQTL 308
                  .|....||.:|......          :||..|...|.  |::. .:|.|..||..|.:
 Frog   124 ------KESRQNSKQKSSPPAPA----------AESCGGDRSPP--GSSA-SKRARTAYTSAQLV 169

  Fly   309 ELEKEFHTNHYLTRRRRIEMAHALCLTERQIKIWFQNRRMKLKKEIQAIKELN 361
            |||||||.|.||.|.||:|||:.|.|:||||||||||||||.||: |.:|.::
 Frog   170 ELEKEFHFNRYLCRPRRVEMANLLNLSERQIKIWFQNRRMKYKKD-QKVKGMS 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UbxNP_536752.1 Homeobox 299..352 CDD:395001 36/52 (69%)
hoxb3NP_001015971.1 Homeobox 160..212 CDD:306543 36/51 (71%)
DUF4074 325..384 CDD:315871
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.