DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubx and Barhl1

DIOPT Version :10

Sequence 1:NP_536752.1 Gene:Ubx / 42034 FlyBaseID:FBgn0003944 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_062319.1 Gene:Barhl1 / 54422 MGIID:1859288 Length:327 Species:Mus musculus


Alignment Length:65 Identity:26/65 - (40%)
Similarity:41/65 - (63%) Gaps:0/65 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   296 RRGRQTYTRYQTLELEKEFHTNHYLTRRRRIEMAHALCLTERQIKIWFQNRRMKLKKEIQAIKEL 360
            |:.|..:|.:|..:||:.|....||:.:.|:|:|.:|.||:.|:|.|:||||.|.|::.....||
Mouse   179 RKARTAFTDHQLAQLERSFERQKYLSVQDRMELAASLNLTDTQVKTWYQNRRTKWKRQTAVGLEL 243

  Fly   361  360
            Mouse   244  243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UbxNP_536752.1 Homeodomain 296..352 CDD:459649 23/55 (42%)
Barhl1NP_062319.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..90
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 113..181 1/1 (100%)
Homeodomain 179..235 CDD:459649 23/55 (42%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 303..327
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.