DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubx and Hoxa7

DIOPT Version :9

Sequence 1:NP_536752.1 Gene:Ubx / 42034 FlyBaseID:FBgn0003944 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_001102703.2 Gene:Hoxa7 / 500126 RGDID:1587253 Length:229 Species:Rattus norvegicus


Alignment Length:253 Identity:91/253 - (35%)
Similarity:112/253 - (44%) Gaps:95/253 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   155 PSACT--PDSRVGGYLDTSGGSPVSHRGGSAGGNVSVSGG--NGNAGGVQS------GVGVAGAG 209
            |::|:  |:|:..||            |..||...|...|  |.|:...|:      |:|    .
  Rat    26 PTSCSFAPNSQRSGY------------GPGAGAFASNVPGLYNVNSPLYQNPFASSYGLG----A 74

  Fly   210 TAWNANCT------------ISGAAAQTAAASSLHQASNHTF--YPWMAIAGECPEDPTKSKIRS 260
            .|:|..|.            ::..|...|....||..:..:|  ||||..:|             
  Rat    75 DAYNLPCASYDQNIPGLCSDLAKGACDKADEGVLHGPAEASFRIYPWMRSSG------------- 126

  Fly   261 DLTQYGGISTDMGKRYSESLAGSLLPDWLGTNGLRRRGRQTYTRYQTLELEKEFHTNHYLTRRRR 325
                                     ||       |:|||||||||||||||||||.|.|||||||
  Rat   127 -------------------------PD-------RKRGRQTYTRYQTLELEKEFHFNRYLTRRRR 159

  Fly   326 IEMAHALCLTERQIKIWFQNRRMKLKKEIQAIKELNEQEKQAQA---QKAAAAAAAAA 380
            ||:|||||||||||||||||||||.|||       ::.|.||..   :.|..:.:.||
  Rat   160 IEIAHALCLTERQIKIWFQNRRMKWKKE-------HKDESQAPTAVPEDAVPSVSTAA 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UbxNP_536752.1 Homeobox 299..352 CDD:395001 48/52 (92%)
Hoxa7NP_001102703.2 Homeobox 133..185 CDD:278475 48/51 (94%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.