DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubx and Hoxb7

DIOPT Version :9

Sequence 1:NP_536752.1 Gene:Ubx / 42034 FlyBaseID:FBgn0003944 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_001017480.1 Gene:Hoxb7 / 497985 RGDID:1559918 Length:219 Species:Rattus norvegicus


Alignment Length:264 Identity:101/264 - (38%)
Similarity:120/264 - (45%) Gaps:85/264 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   139 ANANGQNNPA-------GGMPVRPS-ACTPDSRVGGYLDTSGGSPVSHRGGSAGGNVSVSGGNGN 195
            |||.....||       |..|.:.| |...:.:..||    |..|.:....|..|  ..|||.|.
  Rat     7 ANALFSKYPAASSVFAPGAFPEQTSCAFASNPQRPGY----GAGPGAPFSASVQG--LYSGGGGM 65

  Fly   196 AGGVQSGVGVAGAG---TAWNANC-----TISG---------AAAQTAAASSLHQASNHTFYPWM 243
            ||...:||..||.|   :::|.:|     .:||         |.|:....|.|...||...||||
  Rat    66 AGQSAAGVYEAGYGLEPSSFNMHCAPFEQNLSGVCPGDPAKAAGAKEQRDSDLAAESNFRIYPWM 130

  Fly   244 AIAGECPEDPTKSKIRSDLTQYGGISTDMGKRYSESLAGSLLPDWLGTNGLRRRGRQTYTRYQTL 308
                           ||..|:                              |:||||||||||||
  Rat   131 ---------------RSSGTE------------------------------RKRGRQTYTRYQTL 150

  Fly   309 ELEKEFHTNHYLTRRRRIEMAHALCLTERQIKIWFQNRRMKLKKEI---------QAIKELNEQE 364
            |||||||.|.|||||||||:|||||||||||||||||||||.|||.         |...|.:|:|
  Rat   151 ELEKEFHYNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKENKTSGPGTTGQDKAEADEEE 215

  Fly   365 KQAQ 368
            ::.:
  Rat   216 EEEE 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UbxNP_536752.1 Homeobox 299..352 CDD:395001 48/52 (92%)
Hoxb7NP_001017480.1 Antp-type hexapeptide 126..131 4/19 (21%)
Homeobox 141..193 CDD:278475 48/51 (94%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 193..219 7/25 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45659
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.