DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubx and zen2

DIOPT Version :10

Sequence 1:NP_536752.1 Gene:Ubx / 42034 FlyBaseID:FBgn0003944 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_476794.1 Gene:zen2 / 40827 FlyBaseID:FBgn0004054 Length:252 Species:Drosophila melanogaster


Alignment Length:57 Identity:36/57 - (63%)
Similarity:44/57 - (77%) Gaps:0/57 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   296 RRGRQTYTRYQTLELEKEFHTNHYLTRRRRIEMAHALCLTERQIKIWFQNRRMKLKK 352
            :|.|..::..|.:|||:|||.|.||.|.||||::..|.|||||:|||||||||||||
  Fly    44 KRSRTAFSSLQLIELEREFHLNKYLARTRRIEISQRLALTERQVKIWFQNRRMKLKK 100

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UbxNP_536752.1 Homeodomain 296..352 CDD:459649 34/55 (62%)
zen2NP_476794.1 Homeodomain 44..100 CDD:459649 34/55 (62%)

Return to query results.
Submit another query.