DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubx and Gsx2

DIOPT Version :9

Sequence 1:NP_536752.1 Gene:Ubx / 42034 FlyBaseID:FBgn0003944 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_001131035.2 Gene:Gsx2 / 364140 RGDID:1308047 Length:305 Species:Rattus norvegicus


Alignment Length:288 Identity:88/288 - (30%)
Similarity:115/288 - (39%) Gaps:94/288 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 GGGGGAGGTGGAGNANGGNAANANGQNNPAGGMPVRPSACTPDSRVGGYLDTSGGSPVSH----- 178
            |.||||.||.||..|.||.|..       .|.:|:..|..:|     |..|......|||     
  Rat    77 GAGGGATGTAGAAVAGGGVAGG-------TGALPLLKSQFSP-----GPGDAQFCPRVSHAHHHH 129

  Fly   179 -------------RGGSAGGNVSVSGGNGNAGGVQSGVGVAGAGTAWNANCTISGAAAQTAAASS 230
                         :.|||                      |.|..|         |||..|||::
  Rat   130 HAPQHHHHHHQPQQPGSA----------------------AAAAAA---------AAAAAAAAAA 163

  Fly   231 LHQASNHTFYPWMAIAGECPEDPTKSKIRSDLTQYGGISTDMGKRYSESLAGSLLPDWLGTNGLR 295
            |....:|.  |..|.......||.    |......||..|            |.:|     ||  
  Rat   164 LGHPQHHA--PVCAATTYNVSDPR----RFHCLTMGGSDT------------SQVP-----NG-- 203

  Fly   296 RRGRQTYTRYQTLELEKEFHTNHYLTRRRRIEMAHALCLTERQIKIWFQNRRMKLKKEIQ----- 355
            :|.|..:|..|.||||:||.:|.||:|.||||:|..|.|:|:|:||||||||:|.|||.:     
  Rat   204 KRMRTAFTSTQLLELEREFSSNMYLSRLRRIEIATYLNLSEKQVKIWFQNRRVKHKKEGKGASRN 268

  Fly   356 ---AIKELNEQEKQAQAQKAAAAAAAAA 380
               :.|.:..|...|:::...:.:.|:|
  Rat   269 NHASCKCVGSQAHYARSEDEDSLSPASA 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UbxNP_536752.1 Homeobox 299..352 CDD:395001 31/52 (60%)
Gsx2NP_001131035.2 Homeobox 207..260 CDD:395001 31/52 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.