DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubx and Meox1

DIOPT Version :9

Sequence 1:NP_536752.1 Gene:Ubx / 42034 FlyBaseID:FBgn0003944 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_001102307.1 Gene:Meox1 / 363684 RGDID:1308911 Length:253 Species:Rattus norvegicus


Alignment Length:235 Identity:64/235 - (27%)
Similarity:95/235 - (40%) Gaps:63/235 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   144 QNNPAGGMPVRPSACTPDSRVGGYLDTSGGSPVSHRGGSAGGNVSVSGGNGNAGGVQSGVGVAGA 208
            :.:||  .|..|....|.|..|..|:..........|..:.|.|..:||.|.             
  Rat    81 EQHPA--FPQTPDWHFPISEAGQRLNLGPAGSAREMGAGSPGLVDGTGGLGE------------- 130

  Fly   209 GTAWNANCTISGAAAQTAAASSLHQASNHTFYPWMAIAGECPEDPTKSKIRSDLTQYGGISTDMG 273
                  :|.:.|..|        |:.....              ..:.|.|||..:.||     |
  Rat   131 ------DCMVLGTIA--------HETEKKL--------------SRRKKERSDNPENGG-----G 162

  Fly   274 KRYSESLAGSLLPDWLGTNGLRRRGRQTYTRYQTLELEKEFHTNHYLTRRRRIEMAHALCLTERQ 338
            |....|.|              |:.|..:|:.|..|||.||..::||||.||.|:|..|.|:|||
  Rat   163 KPEGSSKA--------------RKERTAFTKEQLRELEAEFAHHNYLTRLRRYEIAVNLDLSERQ 213

  Fly   339 IKIWFQNRRMKLKKEIQAIKELNEQEKQAQAQKAAAAAAA 378
            :|:||||||||.|: ::..:.::.||:..:...:||:.::
  Rat   214 VKVWFQNRRMKWKR-VKGGQPVSPQEQDPEDGDSAASPSS 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UbxNP_536752.1 Homeobox 299..352 CDD:395001 30/52 (58%)
Meox1NP_001102307.1 COG5576 139..251 CDD:227863 48/153 (31%)
Homeobox 174..227 CDD:395001 30/52 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.