DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubx and HOXB5

DIOPT Version :9

Sequence 1:NP_536752.1 Gene:Ubx / 42034 FlyBaseID:FBgn0003944 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_002138.1 Gene:HOXB5 / 3215 HGNCID:5116 Length:269 Species:Homo sapiens


Alignment Length:325 Identity:105/325 - (32%)
Similarity:135/325 - (41%) Gaps:100/325 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 VNGYKDIWNTGGS----NGGGGGGGGGG--GGGAGGTGGAG-NANG-------GNAANAN----G 143
            ||.:...:..|..    |.|.|....|.  ...|..||..| |.||       .:|::::    |
Human     6 VNSFSGRYPNGPDYQLLNYGSGSSLSGSYRDPAAMHTGSYGYNYNGMDLSVNRSSASSSHFGAVG 70

  Fly   144 QNNPAGGMPVR-------PSACTPDSRVGGYLDTSGGSPVSHRGGSAGGNVSVSGGNGNAGGVQS 201
            :::.|...|.:       .|:|:        |.:....|.:: |.|.|...|.|..:..|....|
Human    71 ESSRAFPAPAQEPRFRQAASSCS--------LSSPESLPCTN-GDSHGAKPSASSPSDQATSASS 126

  Fly   202 GVGVAGAGTAWNANCT-ISGAAAQT---AAASSLHQASNHTFYPW-MAIAGECPEDPT------- 254
                       :||.| |..|:|.:   .|||.|...|.....|. ||.:...||..|       
Human   127 -----------SANFTEIDEASASSEPEEAASQLSSPSLARAQPEPMATSTAAPEGQTPQIFPWM 180

  Fly   255 -KSKIRSDLTQYGGISTDMGKRYSESLAGSLLPDWLGTNGLRRRGRQTYTRYQTLELEKEFHTNH 318
             |..|..|:|                          |.:|  :|.|..||||||||||||||.|.
Human   181 RKLHISHDMT--------------------------GPDG--KRARTAYTRYQTLELEKEFHFNR 217

  Fly   319 YLTRRRRIEMAHALCLTERQIKIWFQNRRMKLKKEIQAIKELNEQEKQAQAQKAAAAAAAAAAVQ 383
            |||||||||:||||||:||||||||||||||.||:              ...|:.:.|.|.:|.|
Human   218 YLTRRRRIEIAHALCLSERQIKIWFQNRRMKWKKD--------------NKLKSMSLATAGSAFQ 268

  Fly   384  383
            Human   269  268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UbxNP_536752.1 Homeobox 299..352 CDD:395001 45/52 (87%)
HOXB5NP_002138.1 PRK07003 <67..>171 CDD:235906 29/123 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 77..173 28/115 (24%)
Antp-type hexapeptide 176..181 0/4 (0%)
Homeobox 198..251 CDD:395001 45/52 (87%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45659
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.