DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubx and HOXB1

DIOPT Version :9

Sequence 1:NP_536752.1 Gene:Ubx / 42034 FlyBaseID:FBgn0003944 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_002135.2 Gene:HOXB1 / 3211 HGNCID:5111 Length:301 Species:Homo sapiens


Alignment Length:310 Identity:92/310 - (29%)
Similarity:114/310 - (36%) Gaps:95/310 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 CNKIYGDGAGAYKQDCLNI-----KADAVNGYKDIWNTGGSNGGGGGGGGGGGGGAGGTGGAGNA 133
            ||:    |..||.......     .|.||:.|       .|.|..||         |.:..|...
Human    15 CNR----GPSAYSAHSAPTSFPPSSAQAVDSY-------ASEGRYGG---------GLSSPAFQQ 59

  Fly   134 NGGNAANANGQNNPAG-GMP--------VRPSACTPDSRVGGYLDTSGGSPVSHRGGSAGGNVSV 189
            |.|..|    |..|:. |:|        ..|:||:|......|.      |:....|. ||....
Human    60 NSGYPA----QQPPSTLGVPFPSSAPSGYAPAACSPSYGPSQYY------PLGQSEGD-GGYFHP 113

  Fly   190 SGGNGNAGGVQSGVGVAGAGTA--------WNANCTISGAAA---------QTAAASSLHQASNH 237
            |......||:..|.|..|||..        :....|.|.|.|         :|...|..:..:..
Human   114 SSYGAQLGGLSDGYGAGGAGPGPYPPQHPPYGNEQTASFAPAYADLLSEDKETPCPSEPNTPTAR 178

  Fly   238 TFYPWMAIAGECPEDPTKSKIRSDLTQYGGISTDMGKRYSESLAGSLLPDWLGTNGLRRRGRQTY 302
            || .||.:    ..:|.|:                 .:.||...||  |..|.||         :
Human   179 TF-DWMKV----KRNPPKT-----------------AKVSEPGLGS--PSGLRTN---------F 210

  Fly   303 TRYQTLELEKEFHTNHYLTRRRRIEMAHALCLTERQIKIWFQNRRMKLKK 352
            |..|..|||||||.|.||:|.||:|:|..|.|.|.|:||||||||||.||
Human   211 TTRQLTELEKEFHFNKYLSRARRVEIAATLELNETQVKIWFQNRRMKQKK 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UbxNP_536752.1 Homeobox 299..352 CDD:395001 31/52 (60%)
HOXB1NP_002135.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 20..77 19/76 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 127..149 4/21 (19%)
Antp-type hexapeptide 179..184 3/5 (60%)
Homeobox 207..259 CDD:278475 33/60 (55%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 254..301 6/7 (86%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.