DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubx and HOXA6

DIOPT Version :9

Sequence 1:NP_536752.1 Gene:Ubx / 42034 FlyBaseID:FBgn0003944 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_076919.1 Gene:HOXA6 / 3203 HGNCID:5107 Length:233 Species:Homo sapiens


Alignment Length:382 Identity:110/382 - (28%)
Similarity:134/382 - (35%) Gaps:164/382 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MNSYFEQASGFYGHPHQATGMAMGSGGHHDQTA--SAAAAAYRGFPLSLGMSPYANHHLQRTTQD 63
            |:|||.       :|.....:..|......|..  .|...|.|.||.|.|.|     .|...|..
Human     1 MSSYFV-------NPTFPGSLPSGQDSFLGQLPLYQAGYDALRPFPASYGAS-----SLPDKTYT 53

  Fly    64 SP--YDASITA-ACNKI-YGDGAGAYKQDCLNIKADAVNGYKDIWNTGGSNGGGGGGGGGGGGGA 124
            ||  |..|.:. |||:. |..||..:..|            ||:  :|.|..|.|          
Human    54 SPCFYQQSNSVLACNRASYEYGASCFYSD------------KDL--SGASPSGSG---------- 94

  Fly   125 GGTGGAGNANGGNAANANGQNNPAGGMPVRP-SACTPDSRVGGYLDTSGGSPVSHRGGSAGGNVS 188
                              .|..|...:...| ....|||                          
Human    95 ------------------KQRGPGDYLHFSPEQQYKPDS-------------------------- 115

  Fly   189 VSGGNGNAGGVQSGVGVAGAGTAWNANCTISGAAAQTAAASSLH-QASNHTF----YPWMAIAGE 248
             |.|.|.|                                  || :.::..:    ||||.....
Human   116 -SSGQGKA----------------------------------LHDEGADRKYTSPVYPWMQRMNS 145

  Fly   249 CPEDPTKSKIRSDLTQYGGISTDMGKRYSESLAGSLLPDWLGTNGLRRRGRQTYTRYQTLELEKE 313
            |                               ||::    .|::|  ||||||||||||||||||
Human   146 C-------------------------------AGAV----YGSHG--RRGRQTYTRYQTLELEKE 173

  Fly   314 FHTNHYLTRRRRIEMAHALCLTERQIKIWFQNRRMKLKKEIQAIKELNEQEKQAQAQ 370
            ||.|.|||||||||:|:|||||||||||||||||||.|||.:.|.......:.::|:
Human   174 FHFNRYLTRRRRIEIANALCLTERQIKIWFQNRRMKWKKENKLINSTQPSGEDSEAK 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UbxNP_536752.1 Homeobox 299..352 CDD:395001 47/52 (90%)
HOXA6NP_076919.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 89..127 15/126 (12%)
Antp-type hexapeptide 136..141 3/4 (75%)
Homeobox 159..212 CDD:365835 47/52 (90%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 214..233 2/17 (12%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45659
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.000

Return to query results.
Submit another query.