DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubx and HOXA5

DIOPT Version :9

Sequence 1:NP_536752.1 Gene:Ubx / 42034 FlyBaseID:FBgn0003944 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_061975.2 Gene:HOXA5 / 3202 HGNCID:5106 Length:270 Species:Homo sapiens


Alignment Length:312 Identity:104/312 - (33%)
Similarity:138/312 - (44%) Gaps:79/312 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 YGDGAGAYKQDCLNIKADAVNGYKDIWNTGGSNGGGGGGGGGGGGGAGGTGGAGNANGGNAAN-- 140
            |||.:...:|            ::|   :...:.|..|.|..|...:.|..|:|:...|..|.  
Human    24 YGDHSSVSEQ------------FRD---SASMHSGRYGYGYNGMDLSVGRSGSGHFGSGERARSY 73

  Fly   141 -ANGQNNPAGGMPVRPSACT----PDSRVGGYLDTSGGSPVSHRGGSAGGNVSVSGGNGNAGGV- 199
             |:....||.....:|:..|    ||......:..|.||. ||.||....:.| ||.:.:||.. 
Human    74 AASASAAPAEPRYSQPATSTHSPQPDPLPCSAVAPSPGSD-SHHGGKNSLSNS-SGASADAGSTH 136

  Fly   200 ---QSGVGVAGAGTAWNANCTISGAAAQTAAASSLHQASNHTFYPWMAIAGECPEDPTKSKIRSD 261
               :.|||.| :|...:|..:...|:||:..:.:  ..:....||||          .|..|..|
Human   137 ISSREGVGTA-SGAEEDAPASSEQASAQSEPSPA--PPAQPQIYPWM----------RKLHISHD 188

  Fly   262 LTQYGGISTDMGKRYSESLAGSLLPDWLGTNGLRRRGRQTYTRYQTLELEKEFHTNHYLTRRRRI 326
                     ::|                |..|  :|.|..||||||||||||||.|.||||||||
Human   189 ---------NIG----------------GPEG--KRARTAYTRYQTLELEKEFHFNRYLTRRRRI 226

  Fly   327 EMAHALCLTERQIKIWFQNRRMKLKKEIQAIKELNEQEKQAQAQKAAAAAAA 378
            |:||||||:||||||||||||||.||           :.:.::...|||..|
Human   227 EIAHALCLSERQIKIWFQNRRMKWKK-----------DNKLKSMSMAAAGGA 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UbxNP_536752.1 Homeobox 299..352 CDD:395001 45/52 (87%)
HOXA5NP_061975.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 75..175 28/104 (27%)
Antp-type hexapeptide 176..181 4/14 (29%)
Homeobox 199..251 CDD:306543 45/51 (88%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45659
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.