DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubx and Hoxc5

DIOPT Version :9

Sequence 1:NP_536752.1 Gene:Ubx / 42034 FlyBaseID:FBgn0003944 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_001101586.1 Gene:Hoxc5 / 315341 RGDID:1307584 Length:222 Species:Rattus norvegicus


Alignment Length:233 Identity:80/233 - (34%)
Similarity:103/233 - (44%) Gaps:58/233 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   134 NGGNAANANGQNNPAGGMPVR----PSACTPDSRVGGYLDTSGGSPVSHRGGSAGGNVSVSG--- 191
            |.|:|:.........||:.:.    |.|  |.:.:.| :|.: .:|.:|....|....:..|   
  Rat    26 NYGSASEVQASRYCYGGLDLSITFPPPA--PSNSLHG-VDMA-ANPRAHPDRPACSAAAAPGHAL 86

  Fly   192 GNGNAGGVQSGV-GVAGAGTAWNANCTISG----AAAQTAAASSLHQ-ASNHTFYPWMAIAGECP 250
            |...|..:..|: ....|..|.......||    ..|||...:.|.| .:....||||       
  Rat    87 GRDEAAPLNPGMYSQKAARPALEERAKSSGEIKEEQAQTGQPAGLSQPPAPPQIYPWM------- 144

  Fly   251 EDPTKSKIRSDLTQYGGISTDMGKRYSESLAGSLLPDWLGTNGLRRRGRQTYTRYQTLELEKEFH 315
               ||..:..:                             |:|  :|.|.:||||||||||||||
  Rat   145 ---TKLHMSHE-----------------------------TDG--KRSRTSYTRYQTLELEKEFH 175

  Fly   316 TNHYLTRRRRIEMAHALCLTERQIKIWFQNRRMKLKKE 353
            .|.|||||||||:|:.|||.||||||||||||||.||:
  Rat   176 FNRYLTRRRRIEIANNLCLNERQIKIWFQNRRMKWKKD 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UbxNP_536752.1 Homeobox 299..352 CDD:395001 43/52 (83%)
Hoxc5NP_001101586.1 COG5373 65..>142 CDD:227665 16/76 (21%)
Homeobox 158..212 CDD:395001 43/53 (81%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 116 1.000 Inparanoid score I4717
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45659
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.960

Return to query results.
Submit another query.