DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubx and HHEX

DIOPT Version :10

Sequence 1:NP_536752.1 Gene:Ubx / 42034 FlyBaseID:FBgn0003944 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_002720.1 Gene:HHEX / 3087 HGNCID:4901 Length:270 Species:Homo sapiens


Alignment Length:71 Identity:30/71 - (42%)
Similarity:46/71 - (64%) Gaps:0/71 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   295 RRRGRQTYTRYQTLELEKEFHTNHYLTRRRRIEMAHALCLTERQIKIWFQNRRMKLKKEIQAIKE 359
            |:.|:..::..||:||||:|.|..||:...|..:|..|.|:|||:|.||||||.|.::..|...:
Human   137 RKGGQVRFSNDQTIELEKKFETQKYLSPPERKRLAKMLQLSERQVKTWFQNRRAKWRRLKQENPQ 201

  Fly   360 LNEQEK 365
            .|::|:
Human   202 SNKKEE 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UbxNP_536752.1 Homeodomain 296..352 CDD:459649 26/55 (47%)
HHEXNP_002720.1 Interaction with SOX13. /evidence=ECO:0000269|PubMed:20028982 1..137 30/71 (42%)
Homeodomain 136..194 CDD:459649 27/56 (48%)
Required for WNT signaling induction. /evidence=ECO:0000269|PubMed:20028982 137..270 30/71 (42%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 194..270 3/14 (21%)

Return to query results.
Submit another query.