DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubx and hoxd11a

DIOPT Version :10

Sequence 1:NP_536752.1 Gene:Ubx / 42034 FlyBaseID:FBgn0003944 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_571242.1 Gene:hoxd11a / 30405 ZFINID:ZDB-GENE-990415-117 Length:276 Species:Danio rerio


Alignment Length:137 Identity:44/137 - (32%)
Similarity:65/137 - (47%) Gaps:33/137 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   217 TISGAAAQTAAASSLHQASNHTFYPWMAIAGECPEDPTKSKIRSDLTQYGGIST-DMGKRYSESL 280
            ::.|.||...:..|..|..               :|||.:     :.:...:|| |..|....|.
Zfish   157 SVPGDAACNPSTDSAEQTK---------------QDPTDT-----VEEESSVSTCDEEKNSGSSA 201

  Fly   281 AGSLLPDWLGTNGLRRRGRQTYTRYQTLELEKEFHTNHYLTRRRRIEMAHALCLTERQIKIWFQN 345
            ..|            |:.|..|::||..|||:||..|.|:.:.:|::::..|.||:||:||||||
Zfish   202 TKS------------RKKRCPYSKYQIRELEREFFFNVYINKEKRLQLSRMLSLTDRQVKIWFQN 254

  Fly   346 RRMKLKK 352
            ||||.||
Zfish   255 RRMKEKK 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UbxNP_536752.1 Homeodomain 296..352 CDD:459649 28/55 (51%)
hoxd11aNP_571242.1 DUF3528 23..144 CDD:432284
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 139..207 15/81 (19%)
Homeodomain 205..261 CDD:459649 28/55 (51%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.