DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubx and dbx1a

DIOPT Version :10

Sequence 1:NP_536752.1 Gene:Ubx / 42034 FlyBaseID:FBgn0003944 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_571233.1 Gene:dbx1a / 30394 ZFINID:ZDB-GENE-000128-8 Length:314 Species:Danio rerio


Alignment Length:93 Identity:32/93 - (34%)
Similarity:47/93 - (50%) Gaps:18/93 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   283 SLLP-----DW-LGTNGLRRRG---RQTYTRYQTLELEKEFHTNHYLTRRRRIEMAHALCLTERQ 338
            |::|     .| |...|..|||   |..::..|...|||.|....|:::..|.::|..|.|.:.|
Zfish   154 SVVPIPGTFSWPLAARGKPRRGMLRRAVFSDVQRKALEKMFQKQKYISKPDRKKLAAKLGLKDSQ 218

  Fly   339 IKIWFQNRRMKLKKEIQAIKELNEQEKQ 366
            :||||||||||.:         |.:|::
Zfish   219 VKIWFQNRRMKWR---------NSKERE 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UbxNP_536752.1 Homeodomain 296..352 CDD:459649 25/58 (43%)
dbx1aNP_571233.1 Homeodomain 178..232 CDD:459649 22/62 (35%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 234..279 1/4 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 292..314
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.