DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubx and hoxc5a

DIOPT Version :9

Sequence 1:NP_536752.1 Gene:Ubx / 42034 FlyBaseID:FBgn0003944 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_571219.2 Gene:hoxc5a / 30379 ZFINID:ZDB-GENE-980526-533 Length:233 Species:Danio rerio


Alignment Length:310 Identity:90/310 - (29%)
Similarity:122/310 - (39%) Gaps:91/310 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 MSPYANHHLQRTTQDSPYDASITAACNKIYGDGAGAYKQDCLNIKADAVNGYKDIWNTGGSNGGG 113
            ||.|......:.|||:       ::|.....|..||:.:  .:....|..|. |:          
Zfish     1 MSSYVGKSFSKQTQDA-------SSCRMHTFDNYGAHSE--FHESNYAYEGL-DL---------- 45

  Fly   114 GGGGGGGGGGAGGTGGAGNANGGNAANANGQNNPAGGMPVRPSACTPDSRVGGYLDTSGGSPVSH 178
                    ||:..:....|:....|.|...:...:..:....|.....||  .::.|.|.:|:||
Zfish    46 --------GGSFSSQIPTNSLRREAINTTDRARSSAAVQRTQSCSALGSR--SFVSTHGYNPLSH 100

  Fly   179 --RGGSAGGNVSV---SGGNGNAGGVQSGVGVAGAGTAWNANCTISGAAAQTAAASSLHQASNHT 238
              ....|.||:.|   ..|......::..              |.|....||.:....:| |...
Zfish   101 GLLSQKAEGNMEVMEKPSGKSRTDDIKME--------------TTSAIKQQTNSTQRQNQ-SQPQ 150

  Fly   239 FYPWMAIAGECPEDPTKSKIRSDLTQYGGISTDMGKRYSESLAGSLLPDWLGTNGLRRRGRQTYT 303
            .||||          ||..:..:                             ::|  :|.|.:||
Zfish   151 IYPWM----------TKLHMSHE-----------------------------SDG--KRSRTSYT 174

  Fly   304 RYQTLELEKEFHTNHYLTRRRRIEMAHALCLTERQIKIWFQNRRMKLKKE 353
            ||||||||||||.|.|||||||||:|:.|||.||||||||||||||.||:
Zfish   175 RYQTLELEKEFHFNRYLTRRRRIEIANNLCLNERQIKIWFQNRRMKWKKD 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UbxNP_536752.1 Homeobox 299..352 CDD:395001 43/52 (83%)
hoxc5aNP_571219.2 Homeobox 169..222 CDD:278475 43/52 (83%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR45659
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.