DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubx and Hoxb3

DIOPT Version :9

Sequence 1:NP_536752.1 Gene:Ubx / 42034 FlyBaseID:FBgn0003944 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_001100512.1 Gene:Hoxb3 / 303488 RGDID:1310780 Length:429 Species:Rattus norvegicus


Alignment Length:358 Identity:94/358 - (26%)
Similarity:121/358 - (33%) Gaps:134/358 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 MGSGGHHDQTASAAAAAYRGFPLSLGMS-------PY-ANHHLQRTTQDSPYDASITAACN-KIY 78
            |....::|.||:|....|..:|.|.|..       |: |..||:...|.|        ||: :..
  Rat     1 MQKATYYDNTAAALFGGYSSYPGSNGFGYDGPPQPPFQAATHLEGDYQRS--------ACSLQSL 57

  Fly    79 GDGAGAYKQDCLNIKADAVNGYKDIWNTGGSNGGGGGGGGGGGGGAGGTGGAGNANGGNAANANG 143
            |:.|.       :.|:..:||  .....|.:........|.....|..|....|:|.|...:.:|
  Rat    58 GNAAP-------HAKSKELNG--SCMRPGLAPEPLPAPPGSPPPSAAPTSTTSNSNNGGGPSKSG 113

  Fly   144 QNNPAGGMPVRPSAC---------------TPDSRVGGYLDTSGGSPVSHRGGSAGGNVSVSGGN 193
                       |..|               ..:||....|..|  ||.:..|...|      ||.
  Rat   114 -----------PPKCGASSNSTLTKQIFPWMKESRQTSKLKNS--SPGTAEGCGGG------GGG 159

  Fly   194 GNAGGVQSGVGVAGAGTAWNANCTISGAAAQTAAASSLHQASNHTFYPWMAIAGECPEDPTKSKI 258
            |..||..||.|.:|.|                                                 
  Rat   160 GGGGGSSSGGGGSGGG------------------------------------------------- 175

  Fly   259 RSDLTQYGGISTDMGKRYSESLAGSLLPDWLGTNGLRRRGRQTYTRYQTLELEKEFHTNHYLTRR 323
                   ||..:..|...|                  :|.|..||..|.:|||||||.|.||.|.
  Rat   176 -------GGDKSPPGSAAS------------------KRARTAYTSAQLVELEKEFHFNRYLCRP 215

  Fly   324 RRIEMAHALCLTERQIKIWFQNRRMKLKKEIQA 356
            ||:|||:.|.|:||||||||||||||.||:.:|
  Rat   216 RRVEMANLLNLSERQIKIWFQNRRMKYKKDQKA 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UbxNP_536752.1 Homeobox 299..352 CDD:395001 36/52 (69%)
Hoxb3NP_001100512.1 Homeobox 191..244 CDD:395001 36/52 (69%)
DUF4074 365..427 CDD:404218
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.