DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubx and hoxc6a

DIOPT Version :9

Sequence 1:NP_536752.1 Gene:Ubx / 42034 FlyBaseID:FBgn0003944 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_571198.1 Gene:hoxc6a / 30346 ZFINID:ZDB-GENE-990415-113 Length:231 Species:Danio rerio


Alignment Length:156 Identity:65/156 - (41%)
Similarity:78/156 - (50%) Gaps:46/156 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   224 QTAAASSLHQASNHTFYPWMAIAGECPEDPTKSKIRSDLTQYGGISTDMGKRYSESLAGSLLPDW 288
            |..|.:...:|:|...||||                ..:..:.|:                    
Zfish   108 QARAGTQDQKANNIQIYPWM----------------QRMNSHSGV-------------------- 136

  Fly   289 LGTNGLRRRGRQTYTRYQTLELEKEFHTNHYLTRRRRIEMAHALCLTERQIKIWFQNRRMKLKKE 353
             |....||||||.|:||||||||||||.|.|||||||||:|:|||||||||||||||||||.|||
Zfish   137 -GYGSDRRRGRQIYSRYQTLELEKEFHFNRYLTRRRRIEIANALCLTERQIKIWFQNRRMKWKKE 200

  Fly   354 IQAIKEL---------NEQEKQAQAQ 370
            ......:         .|.||:.:.:
Zfish   201 TNLTSTVPGTESAGTPQETEKETEEE 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UbxNP_536752.1 Homeobox 299..352 CDD:395001 45/52 (87%)
hoxc6aNP_571198.1 Antp-type hexapeptide 123..128 4/20 (20%)
Homeobox 146..198 CDD:278475 45/51 (88%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 200..231 4/27 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45659
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.