DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubx and hoxb4a

DIOPT Version :9

Sequence 1:NP_536752.1 Gene:Ubx / 42034 FlyBaseID:FBgn0003944 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_571193.1 Gene:hoxb4a / 30340 ZFINID:ZDB-GENE-990415-105 Length:246 Species:Danio rerio


Alignment Length:136 Identity:56/136 - (41%)
Similarity:70/136 - (51%) Gaps:38/136 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   221 AAAQTAAA---SSLHQASNHTFYPWMAIAGECPEDPTKSKIRSDLTQYGGISTDMGKRYSESLAG 282
            |..||..:   |::....:...||||            .|:..::..                  
Zfish   109 ACGQTPTSQNTSTVSSRKDPVVYPWM------------KKVHVNIVS------------------ 143

  Fly   283 SLLPDWLGTNGLRRRGRQTYTRYQTLELEKEFHTNHYLTRRRRIEMAHALCLTERQIKIWFQNRR 347
               |::.|  |..:|.|..|||.|.||||||||.|.|||||||:|:||.|||:||||||||||||
Zfish   144 ---PNYSG--GEPKRSRTAYTRQQVLELEKEFHYNRYLTRRRRVEIAHTLCLSERQIKIWFQNRR 203

  Fly   348 MKLKKE 353
            ||.||:
Zfish   204 MKWKKD 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UbxNP_536752.1 Homeobox 299..352 CDD:395001 41/52 (79%)
hoxb4aNP_571193.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 23..125 4/15 (27%)
Antp-type hexapeptide 130..135 4/16 (25%)
Homeobox 154..207 CDD:278475 41/52 (79%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 210..246 56/136 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.810

Return to query results.
Submit another query.