DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubx and hoxb2a

DIOPT Version :9

Sequence 1:NP_536752.1 Gene:Ubx / 42034 FlyBaseID:FBgn0003944 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_571191.1 Gene:hoxb2a / 30338 ZFINID:ZDB-GENE-990415-103 Length:390 Species:Danio rerio


Alignment Length:236 Identity:74/236 - (31%)
Similarity:97/236 - (41%) Gaps:74/236 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   136 GNAANANGQNNPA-GGMPVRPSACTPDSRVGGYLDTSGGSPVSHRGGSAGGNVSVSGGNGNAGGV 199
            ||.|....|...| .|:.:|.....|.....|....|||:|::|.                    
Zfish    59 GNQARPRSQKRTASNGLQLRTQTAPPTQHQQGPAPLSGGAPLAHE-------------------- 103

  Fly   200 QSGVGVAGAGTAW------NANCTISGAAAQTAAASSLHQASNHTFYPWMAIAGECPEDPTKSKI 258
                      ..|      :..|...||.|..||||....:|.:|      .||  .|.||:.: 
Zfish   104 ----------FPWMKEKKSSKKCPKPGATAAAAAASPSQASSGYT------TAG--LESPTEIQ- 149

  Fly   259 RSDLTQYGGISTDMGKRYSESLAGSLLPDWLGTNGLRRRGRQTYTRYQTLELEKEFHTNHYLTRR 323
                   ||:         ::::||            ||.|..||..|.||||||||.|.||.|.
Zfish   150 -------GGL---------DNVSGS------------RRLRTAYTNTQLLELEKEFHFNKYLCRP 186

  Fly   324 RRIEMAHALCLTERQIKIWFQNRRMKLKKEIQAIKELNEQE 364
            ||:|:|..|.|||||:|:||||||||.|::....::..|.|
Zfish   187 RRVEIAALLDLTERQVKVWFQNRRMKHKRQTTHHRDGQEGE 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UbxNP_536752.1 Homeobox 299..352 CDD:395001 35/52 (67%)
hoxb2aNP_571191.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 40..73 5/13 (38%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 81..100 5/18 (28%)
Antp-type hexapeptide 103..108 1/34 (3%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 108..155 17/71 (24%)
Homeobox 162..214 CDD:278475 35/51 (69%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 211..338 5/17 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.