DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Ubx and Pdx1

DIOPT Version :9

Sequence 1:	NP_536752.1	Gene:	Ubx / 42034	FlyBaseID:	FBgn0003944	Length:	389	Species:	Drosophila melanogaster
Sequence 2:	NP_074043.4	Gene:	Pdx1 / 29535	RGDID:	62387	Length:	283	Species:	Rattus norvegicus

Alignment Length:	117	Identity:	49/117 - (41%)
Similarity:	61/117 - (52%)	Gaps:	28/117 - (23%)

- Green bases have known domain annotations that are detailed below.

  Fly   237 HTFYPWMAIAGECPEDPTKSKIRSDLTQYGGISTDMGKRYSESLAGSLLPDWLGTNGLRRRGRQT 301
            |..:|||          ..:|..:..:|:.|     |...:|       |:      ..:|.|..
  Rat   116 HLPFPWM----------KSTKAHAWKSQWAG-----GAYAAE-------PE------ENKRTRTA 152

  Fly   302 YTRYQTLELEKEFHTNHYLTRRRRIEMAHALCLTERQIKIWFQNRRMKLKKE 353
            |||.|.|||||||..|.|::|.||:|:|..|.||||.|||||||||||.|||
  Rat   153 YTRAQLLELEKEFLFNKYISRPRRVELAVMLNLTERHIKIWFQNRRMKWKKE 204

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Ubx	NP_536752.1	Homeobox	299..352	CDD:395001	35/52 (67%)
Pdx1	NP_074043.4	Transactivation domain	13..73
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	36..81
		Antp-type hexapeptide	118..123		3/14 (21%)
		Homeobox	149..203	CDD:395001	35/53 (66%)
		Nuclear localization signal. /evidence=ECO:0000250	197..203		4/5 (80%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	201..283		3/4 (75%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E2759_KOG0489
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	1	1.000	-	-
TreeFam	0	0.000	Not matched by this tool.
	3	2.810