DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubx and Hoxd4

DIOPT Version :9

Sequence 1:NP_536752.1 Gene:Ubx / 42034 FlyBaseID:FBgn0003944 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_001099355.1 Gene:Hoxd4 / 288153 RGDID:1309690 Length:251 Species:Rattus norvegicus


Alignment Length:264 Identity:78/264 - (29%)
Similarity:102/264 - (38%) Gaps:94/264 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 GGGGGGGGGAGGTGGAGNANGGNAANANGQNNPAGGMPVRPSACTPDSRVGGYLDTSGGSPVSHR 179
            ||||.|.|.|....|.|....|..::.:....|.   |..|.|..|.:|.               
  Rat    63 GGGGPGPGSALPARGHGQEPSGPGSHYSAPGEPC---PAPPPAPLPGARA--------------- 109

  Fly   180 GGSAGGNVSVSGGNGNAGGVQSGVGVAGAGTAWNANCTISGAAAQTAAASSLHQASNHTFYPWMA 244
                                                |:......|....::|.|.:  ..|||| 
  Rat   110 ------------------------------------CSQPTGPKQPPPGTALKQPA--VVYPWM- 135

  Fly   245 IAGECPEDPTKSKIRSDLTQYGGISTDMGKRYSESLAGSLLPDWLGTNGLRRRGRQTYTRYQTLE 309
                       .|:.                     ..|:.|::  |.|..:|.|..|||.|.||
  Rat   136 -----------KKVH---------------------VNSVNPNY--TGGEPKRSRTAYTRQQVLE 166

  Fly   310 LEKEFHTNHYLTRRRRIEMAHALCLTERQIKIWFQNRRMKLKKEIQAIKELNEQEKQAQAQKAAA 374
            ||||||.|.|||||||||:||.|||:||||||||||||||.||:   .|..|.:.:.:.:..:.:
  Rat   167 LEKEFHFNRYLTRRRRIEIAHTLCLSERQIKIWFQNRRMKWKKD---HKLPNTKGRSSSSSSSCS 228

  Fly   375 AAAA 378
            ::||
  Rat   229 SSAA 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UbxNP_536752.1 Homeobox 299..352 CDD:395001 42/52 (81%)
Hoxd4NP_001099355.1 Homeobox 155..209 CDD:395001 42/53 (79%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.810

Return to query results.
Submit another query.