DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubx and Hoxd3

DIOPT Version :9

Sequence 1:NP_536752.1 Gene:Ubx / 42034 FlyBaseID:FBgn0003944 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_001257967.1 Gene:Hoxd3 / 288152 RGDID:1588601 Length:432 Species:Rattus norvegicus


Alignment Length:392 Identity:104/392 - (26%)
Similarity:135/392 - (34%) Gaps:134/392 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 QASGFYGHPHQATGMAMGSGGHHDQTASAAAAAYRGFPLSLGMSPYANHHLQRTTQDSPYDASIT 71
            |.:.:|.:|    |:..|.|      .|.|..|| |:                :|...||..  .
  Rat    18 QKAAYYENP----GLFGGYG------YSKATDAY-GY----------------STPHQPYPP--P 53

  Fly    72 AACNKIYGDGAGAYKQDCLNIKADA-----------VNGYKDIWNTGGSNGGGGGGGGGGGGGAG 125
            ||.|.:..|    |.....:|::.|           :||......||.|.|||||....|     
  Rat    54 AAANSLDSD----YPSSACSIQSSAPLRAPAHKGAELNGSCMRPGTGNSQGGGGGNQPPG----- 109

  Fly   126 GTGGAGNANGGNAANANGQNNPAGGMPVRPSACTPDSRVGGYLDTSGGSPVSHRGGSAGGNVSVS 190
                           .|.:..|.  .|..|....|.|.     .|:.||.|..:....|.|.|  
  Rat   110 ---------------LNSEQQPP--QPPPPPPTLPPSS-----PTNPGSGVPAKKTKGGPNAS-- 150

  Fly   191 GGNGNAGGVQSGVGVAGAGTAWNANCTISGAAAQTAAASSLHQASNHTFYPWMAIAGECPEDPTK 255
                                  :::.|||                 ...:|||      .|....
  Rat   151 ----------------------SSSSTIS-----------------KQIFPWM------KESRQN 170

  Fly   256 SKIRSDLTQYGGISTDMGKRYSESLAGSLLPDWLGTNGLRRRGRQTYTRYQTLELEKEFHTNHYL 320
            ||                ::.|.:.:|....|........:|.|..||..|.:|||||||.|.||
  Rat   171 SK----------------QKNSCATSGENCEDKSPPGPASKRVRTAYTSAQLVELEKEFHFNRYL 219

  Fly   321 TRRRRIEMAHALCLTERQIKIWFQNRRMKLKKEIQAIKELNEQEKQAQAQKAAAAAAAAAAVQGG 385
            .|.||:|||:.|.||||||||||||||||.||:.:|...|:....|:..:......||......|
  Rat   220 CRPRRVEMANLLNLTERQIKIWFQNRRMKYKKDQKAKGILHSPAGQSPERSPPLGGAAGHVAYSG 284

  Fly   386 HL 387
            .|
  Rat   285 QL 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UbxNP_536752.1 Homeobox 299..352 CDD:395001 37/52 (71%)
Hoxd3NP_001257967.1 Homeobox 198..251 CDD:395001 37/52 (71%)
DUF4074 369..430 CDD:404218
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.