DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubx and Hoxb9

DIOPT Version :9

Sequence 1:NP_536752.1 Gene:Ubx / 42034 FlyBaseID:FBgn0003944 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_001093967.1 Gene:Hoxb9 / 287647 RGDID:1306158 Length:250 Species:Rattus norvegicus


Alignment Length:66 Identity:42/66 - (63%)
Similarity:50/66 - (75%) Gaps:1/66 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   287 DWLGTNGLRRRGRQTYTRYQTLELEKEFHTNHYLTRRRRIEMAHALCLTERQIKIWFQNRRMKLK 351
            :||.....|:: |..||:||||||||||..|.||||.||.|:|..|.|:|||:||||||||||:|
  Rat   178 NWLHARSSRKK-RCPYTKYQTLELEKEFLFNMYLTRDRRHEVARLLNLSERQVKIWFQNRRMKMK 241

  Fly   352 K 352
            |
  Rat   242 K 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UbxNP_536752.1 Homeobox 299..352 CDD:395001 37/52 (71%)
Hoxb9NP_001093967.1 Hox9_act 1..172 CDD:398350
Homeobox 188..242 CDD:395001 37/54 (69%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.