powered by:
Protein Alignment Ubx and Hoxb9
DIOPT Version :9
Sequence 1: | NP_536752.1 |
Gene: | Ubx / 42034 |
FlyBaseID: | FBgn0003944 |
Length: | 389 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001093967.1 |
Gene: | Hoxb9 / 287647 |
RGDID: | 1306158 |
Length: | 250 |
Species: | Rattus norvegicus |
Alignment Length: | 66 |
Identity: | 42/66 - (63%) |
Similarity: | 50/66 - (75%) |
Gaps: | 1/66 - (1%) |
- Green bases have known domain annotations that are detailed below.
Fly 287 DWLGTNGLRRRGRQTYTRYQTLELEKEFHTNHYLTRRRRIEMAHALCLTERQIKIWFQNRRMKLK 351
:||.....|:: |..||:||||||||||..|.||||.||.|:|..|.|:|||:||||||||||:|
Rat 178 NWLHARSSRKK-RCPYTKYQTLELEKEFLFNMYLTRDRRHEVARLLNLSERQVKIWFQNRRMKMK 241
Fly 352 K 352
|
Rat 242 K 242
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0000007 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
1 |
1.000 |
- |
- |
|
|
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.910 |
|
Return to query results.
Submit another query.