DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubx and GBX2

DIOPT Version :9

Sequence 1:NP_536752.1 Gene:Ubx / 42034 FlyBaseID:FBgn0003944 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_001476.2 Gene:GBX2 / 2637 HGNCID:4186 Length:348 Species:Homo sapiens


Alignment Length:230 Identity:66/230 - (28%)
Similarity:92/230 - (40%) Gaps:43/230 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   165 GGYLDTSGGSPVSHRGGSAGGNVS----VSGGNGNAGGVQSGVGVAGAGTAWNANCTISGAAAQT 225
            ||:    ..|| .|:..:|....:    ..|||.:...........|.|........::.:||:|
Human   110 GGF----SASP-QHQEAAAARKFAPQPLPGGGNFDKAEALQADAEDGKGFLAKEGSLLAFSAAET 169

  Fly   226 AAASSLHQASNHTFYPWMAIAGECP-----EDPTKSK-----IRSDLT---------QYGGISTD 271
            ..||.:.           |:.|:..     ||..|.|     :.||:.         |......|
Human   170 VQASLVG-----------AVRGQGKDESKVEDDPKGKEESFSLESDVDYSSDDNLTGQAAHKEED 223

  Fly   272 MGKRYSESLAGSLLPDWLGTNGLRRRGRQTYTRYQTLELEKEFHTNHYLTRRRRIEMAHALCLTE 336
            .|....|:...|.......:.|..||.|..:|..|.||||||||...||:...|.::||||.|:|
Human   224 PGHALEETPPSSGAAGSTTSTGKNRRRRTAFTSEQLLELEKEFHCKKYLSLTERSQIAHALKLSE 288

  Fly   337 RQIKIWFQNRRMKLKKEIQAIKELNEQEKQAQAQK 371
            .|:||||||||.|.|:    :|..|...|..:..:
Human   289 VQVKIWFQNRRAKWKR----VKAGNANSKTGEPSR 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UbxNP_536752.1 Homeobox 299..352 CDD:395001 30/52 (58%)
GBX2NP_001476.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 59..81
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 111..139 8/32 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 179..251 15/71 (21%)
Homeobox 250..303 CDD:306543 30/52 (58%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.