DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubx and Hoxc6

DIOPT Version :9

Sequence 1:NP_536752.1 Gene:Ubx / 42034 FlyBaseID:FBgn0003944 Length:389 Species:Drosophila melanogaster
Sequence 2:XP_038936324.1 Gene:Hoxc6 / 252885 RGDID:620626 Length:243 Species:Rattus norvegicus


Alignment Length:271 Identity:83/271 - (30%)
Similarity:117/271 - (43%) Gaps:80/271 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 NP------AGGMPVRPSACTPDSRVGGYLDTSGGSPVSHRGGSAGGNVSVSGGNGNAGGVQSGVG 204
            ||      |||..|.|:..         |:::...||.|                        ..
  Rat     7 NPSLSCHLAGGQDVLPNVA---------LNSTAYDPVRH------------------------FS 38

  Fly   205 VAGAGTAWNANCTISGAAAQT----AAASSLHQASNHTFYPWMAIAGECPEDPTKSKIRSDLTQY 265
            ..||..|.|...:....:.|.    :::...:...:::||....:...|.::......::.:.| 
  Rat    39 TYGAAVAQNRIYSTPFYSPQENVVFSSSRGPYDYGSNSFYQEKDMLSNCRQNTLGHNTQTSIAQ- 102

  Fly   266 GGISTDMGKRYSESLAGSL-LPDWL------------GTNGL-----RRRGRQTYTRYQTLELEK 312
             ..|::.|:...:....|: :..|:            |:.|:     ||||||.|:|||||||||
  Rat   103 -DFSSEQGRTAPQDQKASIQIYPWMQRMNSHSVCFVPGSLGVGYGADRRRGRQIYSRYQTLELEK 166

  Fly   313 EFHTNHYLTRRRRIEMAHALCLTERQIKIWFQNRRMKLKKEIQAI-----------------KEL 360
            |||.|.|||||||||:|:|||||||||||||||||||.|||....                 ||.
  Rat   167 EFHFNRYLTRRRRIEIANALCLTERQIKIWFQNRRMKWKKESNLTSTLSGGGGGATADSLGGKEE 231

  Fly   361 NEQEKQAQAQK 371
            ..:|.:.:.||
  Rat   232 KREETEEEKQK 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UbxNP_536752.1 Homeobox 299..352 CDD:395001 45/52 (87%)
Hoxc6XP_038936324.1 Homeobox 153..206 CDD:395001 45/52 (87%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45659
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.