DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubx and Bsx

DIOPT Version :10

Sequence 1:NP_536752.1 Gene:Ubx / 42034 FlyBaseID:FBgn0003944 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_839976.1 Gene:Bsx / 244813 MGIID:2669849 Length:232 Species:Mus musculus


Alignment Length:75 Identity:22/75 - (29%)
Similarity:34/75 - (45%) Gaps:10/75 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 LDSYYHKRDAPSNSTSWMISVVYVTFYFIIVLGVKYYNRMWVYPVLQSFSIDLFVISYILSVVIF 191
            ::.:..:...|..|..| .|..|.||.||:....|     |:  :|..| |.||:|.: |.|.::
Mouse  2012 MNPHLEEPQRPETSFLW-FSSPYKTFRFIVWRRFK-----WL--ILGLF-ILLFIILF-LGVFLY 2066

  Fly   192 FILLKAACKL 201
            .....||.|:
Mouse  2067 AFPNYAAMKM 2076

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UbxNP_536752.1 Homeodomain 296..352 CDD:459649
BsxNP_839976.1 Homeodomain 111..167 CDD:459649
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 160..232
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.