DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubx and GSX1

DIOPT Version :10

Sequence 1:NP_536752.1 Gene:Ubx / 42034 FlyBaseID:FBgn0003944 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_663632.1 Gene:GSX1 / 219409 HGNCID:20374 Length:264 Species:Homo sapiens


Alignment Length:136 Identity:53/136 - (38%)
Similarity:69/136 - (50%) Gaps:36/136 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   218 ISGAAAQTAAASSLHQASNHTFYPWMAIAGECPEDPTKSKIRSDLTQYGGISTDMGKRYSESLAG 282
            ::...|..|||::|:|.|    ||.        .||         .|:..||.|..   |..|..
Human   106 VAHGPAAAAAAAALYQTS----YPL--------PDP---------RQFHCISVDSS---SNQLPS 146

  Fly   283 SLLPDWLGTNGLRRRGRQTYTRYQTLELEKEFHTNHYLTRRRRIEMAHALCLTERQIKIWFQNRR 347
            |            :|.|..:|..|.||||:||.:|.||:|.||||:|..|.|:|:|:||||||||
Human   147 S------------KRMRTAFTSTQLLELEREFASNMYLSRLRRIEIATYLNLSEKQVKIWFQNRR 199

  Fly   348 MKLKKE 353
            :|.|||
Human   200 VKHKKE 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UbxNP_536752.1 Homeodomain 296..352 CDD:459649 32/55 (58%)
GSX1NP_663632.1 SNAG domain. /evidence=ECO:0000250 1..20
Homeodomain 148..204 CDD:459649 32/55 (58%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 201..264 4/5 (80%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.