DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubx and Hoxc10

DIOPT Version :10

Sequence 1:NP_536752.1 Gene:Ubx / 42034 FlyBaseID:FBgn0003944 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_034592.2 Gene:Hoxc10 / 209448 MGIID:96192 Length:342 Species:Mus musculus


Alignment Length:53 Identity:14/53 - (26%)
Similarity:21/53 - (39%) Gaps:21/53 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 ILLTNLAFVLNVVYSTLVVIGYKSK-------------------TIKEVVDFM 73
            ::|:.|.|||  :..||:|...|.|                   |...:|||:
Mouse     4 VVLSVLVFVL--ISLTLLVYRLKKKKTDNTGTCGSSNITVEQDNTTYSMVDFI 54

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UbxNP_536752.1 Homeodomain 296..352 CDD:459649
Hoxc10NP_034592.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20 7/17 (41%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 186..271
Homeodomain 269..325 CDD:459649
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.