DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubx and cog-1

DIOPT Version :10

Sequence 1:NP_536752.1 Gene:Ubx / 42034 FlyBaseID:FBgn0003944 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_001022264.1 Gene:cog-1 / 175149 WormBaseID:WBGene00000584 Length:256 Species:Caenorhabditis elegans


Alignment Length:104 Identity:34/104 - (32%)
Similarity:55/104 - (52%) Gaps:4/104 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   254 TKSKIRSDLTQYGGISTDMGKRYSESLAGSLLPDW-LGTNGL---RRRGRQTYTRYQTLELEKEF 314
            |:..:...||.:..::...|...|.|..|.|.... |..|.|   :::.|.|:|.:|..:||::|
 Worm   124 TQENVSRALTSFNLLNNLPGALPSLSPMGRLQHSMQLSPNSLNMQKKQSRPTFTGHQIYQLERKF 188

  Fly   315 HTNHYLTRRRRIEMAHALCLTERQIKIWFQNRRMKLKKE 353
            ....||....|.::|..|.::|.|:|:||||||.|.:|:
 Worm   189 EQTKYLAGADRAQLAQELNMSESQVKVWFQNRRTKWRKK 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UbxNP_536752.1 Homeodomain 296..352 CDD:459649 22/55 (40%)
cog-1NP_001022264.1 Homeodomain 170..226 CDD:459649 22/55 (40%)

Return to query results.
Submit another query.