DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubx and DLX4

DIOPT Version :10

Sequence 1:NP_536752.1 Gene:Ubx / 42034 FlyBaseID:FBgn0003944 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_612138.1 Gene:DLX4 / 1748 HGNCID:2917 Length:240 Species:Homo sapiens


Alignment Length:57 Identity:24/57 - (42%)
Similarity:32/57 - (56%) Gaps:0/57 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   296 RRGRQTYTRYQTLELEKEFHTNHYLTRRRRIEMAHALCLTERQIKIWFQNRRMKLKK 352
            |:.|..|:..|...|.:.|....||....|.::|..|.||:.|:||||||:|.|.||
Human   118 RKPRTIYSSLQLQHLNQRFQHTQYLALPERAQLAAQLGLTQTQVKIWFQNKRSKYKK 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UbxNP_536752.1 Homeodomain 296..352 CDD:459649 22/55 (40%)
DLX4NP_612138.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 80..120 1/1 (100%)
Homeodomain 118..174 CDD:459649 22/55 (40%)

Return to query results.
Submit another query.