DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubx and Meox1

DIOPT Version :9

Sequence 1:NP_536752.1 Gene:Ubx / 42034 FlyBaseID:FBgn0003944 Length:389 Species:Drosophila melanogaster
Sequence 2:XP_036012267.1 Gene:Meox1 / 17285 MGIID:103220 Length:271 Species:Mus musculus


Alignment Length:309 Identity:64/309 - (20%)
Similarity:91/309 - (29%) Gaps:113/309 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 GFYGHPHQATGMAMGSGGH-------HDQTASAAAAAYRGFPLS-LGMSPYANHHLQRTTQDSPY 66
            |...:||.....|.|...:       |.::...|.|||..|..| |..:|   |.|.||      
Mouse    20 GCLRNPHSEDSSASGLSHYPPTPFSFHQKSDFPATAAYPDFSASCLAATP---HSLPRT------ 75

  Fly    67 DASITAACNKIYGDGAGAYKQDCLNIKADAVNGYKDIWNTGGSNGG-----GGGG-----GGGGG 121
                    .:|:.:...|:.|             ...|:...|..|     |..|     |.|..
Mouse    76 --------ERIFNEQHPAFPQ-------------TPDWHFPISEAGQRLNLGPAGSAREMGAGSP 119

  Fly   122 GGAGGTGGAGN--ANGGNAAN-----ANGQNNPAGGMPVRPSACTPDSRVGGYLDTSGGSPVSHR 179
            |...||.|.|.  ...|..||     ::.:.....|..:.|.   |:..|    :|.       .
Mouse   120 GLVDGTAGLGEDCMVLGTIANETEKKSSRRKKERSGQSLVPE---PEDEV----ETC-------E 170

  Fly   180 GGSAGGNVSVSGGNGNAGGVQSGVGVAGAGTAWNANCTISGAAAQTAAASSLHQASNHTF-YPWM 243
            ||||              .|.:|.|..|.|.     |:.|....:.:...:..:...... :|  
Mouse   171 GGSA--------------CVPTGAGPRGWGL-----CSFSKFRVRCSKDQNQERLKEPPLQFP-- 214

  Fly   244 AIAGECPEDPTKS-----------KIRSDLTQYGGISTDMGKRYSESLA 281
                  |..||.|           .:|.::.||.|     ...:.|.||
Mouse   215 ------PPGPTLSHLWTHPGQPAHTLRCEVAQYVG-----ALNFPEGLA 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UbxNP_536752.1 Homeobox 299..352 CDD:395001
Meox1XP_036012267.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.