DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubx and Hoxd1

DIOPT Version :9

Sequence 1:NP_536752.1 Gene:Ubx / 42034 FlyBaseID:FBgn0003944 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_034597.2 Gene:Hoxd1 / 15429 MGIID:96201 Length:328 Species:Mus musculus


Alignment Length:356 Identity:93/356 - (26%)
Similarity:127/356 - (35%) Gaps:150/356 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 SNGGGGGGGGGGGGGAG---------------------GTGGAGNANGGNAANANGQNNPAGG-- 150
            |...|||.||.||...|                     |:|.....:....|.|....:|..|  
Mouse     9 SCAAGGGSGGVGGDVLGFAPKFCRADARPVALQPAFPLGSGDGAFVSCLPLATARPTPSPPAGPA 73

  Fly   151 -MPV-RPSA-----CTPDSRVGGYLDTSGGSPVS-----------------------HRGG---- 181
             .|| :|:|     ||.:   |.|  ..|.:|.|                       ..||    
Mouse    74 QSPVPQPAAPRYAPCTLE---GAY--ERGAAPASAAEYGFLGSGPAFDFPGALGRAADEGGAHVH 133

  Fly   182 -------SAGGNVSVSG--------------------GNGNAGGVQSGVGVAGAGTAWNANCTIS 219
                   |.||:..:||                    .:|:.|..|                |:|
Mouse   134 YATSAVFSGGGSFLLSGQVDFAAFGEPGPFPACLKEPADGHPGPFQ----------------TVS 182

  Fly   220 ---GAAAQTAAASSLHQASNHTFYPWMAIAGECPEDPTKSKIRSDLTQYGGISTDMGKRYSESLA 281
               ||..:.|:.:|...|::.|| .||.:....|:       :|.|::||..|.           
Mouse   183 PAPGACPKPASPTSSLPAAHSTF-EWMKVKRNAPK-------KSKLSEYGATSP----------- 228

  Fly   282 GSLLPDWLGTNGLRRRGRQTYTRYQTLELEKEFHTNHYLTRRRRIEMAHALCLTERQIKIWFQNR 346
                |..:.||         ::..|..|||||||.|.||||.||||:|:.|.|.:.|:|||||||
Mouse   229 ----PSAIRTN---------FSTKQLTELEKEFHFNKYLTRARRIEIANCLQLNDTQVKIWFQNR 280

  Fly   347 RMKLKKEIQAIKELNEQEKQAQAQKAAAAAA 377
            |||.||          :|::.....||:.|:
Mouse   281 RMKQKK----------REREGLLATAASVAS 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UbxNP_536752.1 Homeobox 299..352 CDD:395001 31/52 (60%)
Hoxd1NP_034597.2 PRK04233 59..>105 CDD:305134 15/50 (30%)
Antp-type hexapeptide 204..209 3/5 (60%)
Homeobox 233..285 CDD:278475 33/60 (55%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 304..328
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.