Sequence 1: | NP_536752.1 | Gene: | Ubx / 42034 | FlyBaseID: | FBgn0003944 | Length: | 389 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_034591.1 | Gene: | Hoxb8 / 15416 | MGIID: | 96189 | Length: | 243 | Species: | Mus musculus |
Alignment Length: | 271 | Identity: | 87/271 - (32%) |
---|---|---|---|
Similarity: | 112/271 - (41%) | Gaps: | 87/271 - (32%) |
- Green bases have known domain annotations that are detailed below.
Fly 150 GMPVRPS--ACTPDSRVGGYLDTSGGSPVSHRGGSAGGN-------------------------- 186
Fly 187 --VSVSGGNGNAGGV-----QSGVGVAGAGTAWNANCTISGAAAQTAAASSLHQASNHT-FYPWM 243
Fly 244 AIAGECPEDPTKSKIRSDLTQYGGISTDMGKRYSESLAGSLLPDWLGTNGLRRRGRQTYTRYQTL 308
Fly 309 ELEKEFHTNHYLTRRRRIEMAHALCLTERQIKIWFQNRRMKLKKEIQAIKELNEQEKQAQAQKAA 373
Fly 374 AAAAAAAAVQG 384 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Ubx | NP_536752.1 | Homeobox | 299..352 | CDD:395001 | 42/52 (81%) |
Hoxb8 | NP_034591.1 | Antp-type hexapeptide | 134..139 | 2/4 (50%) | |
Homeobox | 150..203 | CDD:395001 | 42/52 (81%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 203..243 | 9/33 (27%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG0489 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0000007 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
4 | 3.810 |