DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubx and Hoxb8

DIOPT Version :9

Sequence 1:NP_536752.1 Gene:Ubx / 42034 FlyBaseID:FBgn0003944 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_034591.1 Gene:Hoxb8 / 15416 MGIID:96189 Length:243 Species:Mus musculus


Alignment Length:271 Identity:87/271 - (32%)
Similarity:112/271 - (41%) Gaps:87/271 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   150 GMPVRPS--ACTPDSRVGGYLDTSGGSPVSHRGGSAGGN-------------------------- 186
            |..:||:  .|       |:....||.|....|.|:||:                          
Mouse    16 GESLRPNYYDC-------GFAQDLGGRPTVVYGPSSGGSFQHPSQIQEFYHGPSSLSTAPYQQNP 73

  Fly   187 --VSVSGGNGNAGGV-----QSGVGVAGAGTAWNANCTISGAAAQTAAASSLHQASNHT-FYPWM 243
              |:..|..||..|.     ||..|.........|:|.::.|:.....|....|:.:.| .:|||
Mouse    74 CAVACHGDPGNFYGYDPLQRQSLFGAQDPDLVQYADCKLAAASGLGEEAEGSEQSPSPTQLFPWM 138

  Fly   244 AIAGECPEDPTKSKIRSDLTQYGGISTDMGKRYSESLAGSLLPDWLGTNGLRRRGRQTYTRYQTL 308
            .                                .::.||            ||||||||:|||||
Mouse   139 R--------------------------------PQAAAG------------RRRGRQTYSRYQTL 159

  Fly   309 ELEKEFHTNHYLTRRRRIEMAHALCLTERQIKIWFQNRRMKLKKEIQAIKELNEQEKQAQAQKAA 373
            ||||||..|.||||:||||::|||.|||||:||||||||||.|||....|..:.:.:|.:.:|..
Mouse   160 ELEKEFLFNPYLTRKRRIEVSHALGLTERQVKIWFQNRRMKWKKENNKDKFPSSKCEQEELEKEK 224

  Fly   374 AAAAAAAAVQG 384
            ...|...|.||
Mouse   225 LERAPETAEQG 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UbxNP_536752.1 Homeobox 299..352 CDD:395001 42/52 (81%)
Hoxb8NP_034591.1 Antp-type hexapeptide 134..139 2/4 (50%)
Homeobox 150..203 CDD:395001 42/52 (81%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 203..243 9/33 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.