DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubx and Hoxb6

DIOPT Version :9

Sequence 1:NP_536752.1 Gene:Ubx / 42034 FlyBaseID:FBgn0003944 Length:389 Species:Drosophila melanogaster
Sequence 2:XP_006532355.1 Gene:Hoxb6 / 15414 MGIID:96187 Length:309 Species:Mus musculus


Alignment Length:260 Identity:95/260 - (36%)
Similarity:120/260 - (46%) Gaps:82/260 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   141 ANGQNNPAGGMPVRPSACTPDSRVGGYLD-------TSGGSPVSHRGGSAGGNVSVSGGNGNAGG 198
            |:||.:..|.:|:..|         ||.|       ..|..|...:|.:|......:||      
Mouse   100 ASGQESFLGQLPLYSS---------GYADPLRHYPAPYGPGPGQDKGFAASSYYPPAGG------ 149

  Fly   199 VQSGVGVA-----GAGTAW----NANCTISGAAAQTAAASSLHQASNHTFYPWMAIAGECPEDPT 254
               |.|.|     |...|:    :|.|.:|||....            .|:|          :|.
Mouse   150 ---GYGRAAPCDYGPAPAFYREKDAACALSGADEPP------------PFHP----------EPR 189

  Fly   255 KSKIRSDLTQYGGISTDMGKRYSESLAGSLLPDWL-----------GTNGLRRRGRQTYTRYQTL 308
            ||....|.:.:|        ...|....:.:..|:           |.:|  |||||||||||||
Mouse   190 KSDCAQDKSVFG--------ETEEQKCSTPVYPWMQRMNSCNSSSFGPSG--RRGRQTYTRYQTL 244

  Fly   309 ELEKEFHTNHYLTRRRRIEMAHALCLTERQIKIWFQNRRMKLKKE--IQAIKELN---EQEKQAQ 368
            |||||||.|.|||||||||:|||||||||||||||||||||.|||  :.:..:|:   |:||.|:
Mouse   245 ELEKEFHYNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKESKLLSASQLSAEEEEEKPAE 309

  Fly   369  368
            Mouse   310  309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UbxNP_536752.1 Homeobox 299..352 CDD:395001 48/52 (92%)
Hoxb6XP_006532355.1 Homeobox 235..288 CDD:365835 48/52 (92%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45659
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.