DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubx and Hoxb5

DIOPT Version :9

Sequence 1:NP_536752.1 Gene:Ubx / 42034 FlyBaseID:FBgn0003944 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_032294.2 Gene:Hoxb5 / 15413 MGIID:96186 Length:269 Species:Mus musculus


Alignment Length:405 Identity:109/405 - (26%)
Similarity:139/405 - (34%) Gaps:159/405 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MNSYFEQA-SGFY--GHPHQATGMAMG---SGGHHDQTASAAAA---AYRGFPLSLGMSPYANHH 56
            |:|||..: ||.|  |..:|......|   ||.:.|..|....:   .|.|..||:..|..::.|
Mouse     1 MSSYFVNSFSGRYPNGPDYQLLNYGSGSSLSGSYRDPAAMHTGSYGYNYNGMDLSVNRSSASSSH 65

  Fly    57 LQRTTQDS---------PYDASITAACNKIYGDGAGAYKQDCLNIKADAVNGYKDIWNTGGSNGG 112
            .....:.|         |.....|::|:.     :......|.|               |.|:| 
Mouse    66 FGAVGESSRAFPASAQEPRFRQATSSCSL-----SSPESLPCTN---------------GDSHG- 109

  Fly   113 GGGGGGGGGGGAGGTGGAGNANGGNAANANGQNNPAGGMPVRPSACTPDSRVGGYLDTSGGSPVS 177
                                                    .:|||.:|..:         .:|.|
Mouse   110 ----------------------------------------AKPSASSPSDQ---------ATPAS 125

  Fly   178 HRGGSAG----GNVSVSGGNGNAGGVQSGVGVAGAGTAWNANCTISGAAAQTAAASSLHQASNHT 238
               .||.    ...|.|.....|....|...:|.|..        ...|..|||.    :.....
Mouse   126 ---SSANFTEIDEASASSEPEEAASQLSSPSLARAQP--------EPMATSTAAP----EGQTPQ 175

  Fly   239 FYPWMAIAGECPEDPTKSKIRSDLTQYGGISTDMGKRYSESLAGSLLPDWLGTNGLRRRGRQTYT 303
            .:|||          .|..|..|:|                          |.:|  :|.|..||
Mouse   176 IFPWM----------RKLHISHDMT--------------------------GPDG--KRARTAYT 202

  Fly   304 RYQTLELEKEFHTNHYLTRRRRIEMAHALCLTERQIKIWFQNRRMKLKKEIQAIKELNEQEKQAQ 368
            ||||||||||||.|.|||||||||:||||||:||||||||||||||.||:              .
Mouse   203 RYQTLELEKEFHFNRYLTRRRRIEIAHALCLSERQIKIWFQNRRMKWKKD--------------N 253

  Fly   369 AQKAAAAAAAAAAVQ 383
            ..|:.:.|.|.:|.|
Mouse   254 KLKSMSLATAGSAFQ 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UbxNP_536752.1 Homeobox 299..352 CDD:395001 45/52 (87%)
Hoxb5NP_032294.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 75..173 26/182 (14%)
Antp-type hexapeptide 176..181 3/14 (21%)
Homeobox 198..251 CDD:365835 45/52 (87%)
PRK07003 <67..>171 CDD:235906 27/188 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45659
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.