DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubx and Hoxa4

DIOPT Version :9

Sequence 1:NP_536752.1 Gene:Ubx / 42034 FlyBaseID:FBgn0003944 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_032291.1 Gene:Hoxa4 / 15401 MGIID:96176 Length:285 Species:Mus musculus


Alignment Length:289 Identity:91/289 - (31%)
Similarity:110/289 - (38%) Gaps:65/289 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 GGGGGGGGAGGTGGAGNANGGNAANANGQNNPAGGMP---VRPSACTPDSRVGGYLDTSGGSPVS 177
            ||.|||.||.| ||.|.....:|.:....|..|...|   ..|.|..|....|.|...:...|.:
Mouse    27 GGPGGGDGAVG-GGPGYPRPQSAPHLPAPNPHAARQPPAYYAPRAREPSYPGGLYPAPAAACPYA 90

  Fly   178 HRGGS-AGGNVSVSGG--------------NGNAGGVQSGVGVAGAGTAWNANCTISGAAAQTAA 227
            .||.| |....|.:.|              :...|.....|...|:..|........|.|..   
Mouse    91 CRGASPARPEQSPAPGAHPSPAPQPPAPPRHCAPGPTTPAVATGGSAPACPLLLADQGPAGP--- 152

  Fly   228 ASSLHQASNHTFYPWMAIAGECPEDPTKSKIRSDLTQYGGISTDMGKRYSESLAGSLLPDWLGTN 292
                 :......||||          .|..:.:..:.|.|                         
Mouse   153 -----KGKEPVVYPWM----------KKIHVSAVNSSYNG------------------------- 177

  Fly   293 GLRRRGRQTYTRYQTLELEKEFHTNHYLTRRRRIEMAHALCLTERQIKIWFQNRRMKLKKEIQAI 357
            |..:|.|..|||.|.||||||||.|.|||||||||:||.|||:|||:||||||||||.||:   .
Mouse   178 GEPKRSRTAYTRQQVLELEKEFHFNRYLTRRRRIEIAHTLCLSERQVKIWFQNRRMKWKKD---H 239

  Fly   358 KELNEQEKQAQAQKAAAAAAAAAAVQGGH 386
            |..|.:.:.:....|.|.....|.....|
Mouse   240 KLPNTKMRSSNTASAPAGPPGKAQTHSPH 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UbxNP_536752.1 Homeobox 299..352 CDD:395001 41/52 (79%)
Hoxa4NP_032291.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 19..70 16/43 (37%)
Antp-type hexapeptide 159..164 4/14 (29%)
Homeobox 183..236 CDD:278475 41/52 (79%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 238..285 6/34 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.810

Return to query results.
Submit another query.