DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubx and Hoxa2

DIOPT Version :9

Sequence 1:NP_536752.1 Gene:Ubx / 42034 FlyBaseID:FBgn0003944 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_034581.1 Gene:Hoxa2 / 15399 MGIID:96174 Length:372 Species:Mus musculus


Alignment Length:195 Identity:66/195 - (33%)
Similarity:90/195 - (46%) Gaps:32/195 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   207 GAGTAWNANCTISGAAAQTAAASSLHQASNHTFYPWMAIAGECPEDPTKSKIRSDLTQYGGISTD 271
            |||.......:.:|:......|.:|....    ||||           |.|..:..|.....:..
Mouse    68 GAGVGGRPKSSPAGSRGSPVPAGALQPPE----YPWM-----------KEKKAAKKTALPPAAAS 117

  Fly   272 MGKR---YSESLAGSLLPDWLGTNGLRRRGRQTYTRYQTLELEKEFHTNHYLTRRRRIEMAHALC 333
            .|..   :.|||.   :.|  |:.|..||.|..||..|.||||||||.|.||.|.||:|:|..|.
Mouse   118 TGPACLGHKESLE---IAD--GSGGGSRRLRTAYTNTQLLELEKEFHFNKYLCRPRRVEIAALLD 177

  Fly   334 LTERQIKIWFQNRRMKLKKEIQA---------IKELNEQEKQAQAQKAAAAAAAAAAVQGGHLDQ 389
            |||||:|:||||||||.|::.|.         .|.|.:.:|..:.::..:....|.:|.|..|::
Mouse   178 LTERQVKVWFQNRRMKHKRQTQCKENQNSEGKFKNLEDSDKVEEDEEEKSLFEQALSVSGALLER 242

  Fly   390  389
            Mouse   243  242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UbxNP_536752.1 Homeobox 299..352 CDD:395001 35/52 (67%)
Hoxa2NP_034581.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 48..95 6/26 (23%)
Antp-type hexapeptide 96..101 4/19 (21%)
Homeobox 143..195 CDD:278475 35/51 (69%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 194..225 5/30 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.