DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubx and Hmx2

DIOPT Version :10

Sequence 1:NP_536752.1 Gene:Ubx / 42034 FlyBaseID:FBgn0003944 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_666110.1 Gene:Hmx2 / 15372 MGIID:107159 Length:273 Species:Mus musculus


Alignment Length:42 Identity:9/42 - (21%)
Similarity:27/42 - (64%) Gaps:1/42 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   142 SWMISVVYVTFYFIIVLGVKYYNRMWVYPVLQSFSIDLFVIS 183
            ::::..:.|.| ..:|||::.:.|:::.|..::.|.:|.:::
Mouse     2 NFLLETLRVLF-LSLVLGLEAFVRLFIPPRRKNVSGELVLLT 42

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UbxNP_536752.1 Homeodomain 296..352 CDD:459649
Hmx2NP_666110.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..154 9/42 (21%)
Homeodomain 150..206 CDD:459649
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.