| Sequence 1: | NP_536752.1 | Gene: | Ubx / 42034 | FlyBaseID: | FBgn0003944 | Length: | 389 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_666110.1 | Gene: | Hmx2 / 15372 | MGIID: | 107159 | Length: | 273 | Species: | Mus musculus |
| Alignment Length: | 42 | Identity: | 9/42 - (21%) |
|---|---|---|---|
| Similarity: | 27/42 - (64%) | Gaps: | 1/42 - (2%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 142 SWMISVVYVTFYFIIVLGVKYYNRMWVYPVLQSFSIDLFVIS 183 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Ubx | NP_536752.1 | Homeodomain | 296..352 | CDD:459649 | |
| Hmx2 | NP_666110.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..154 | 9/42 (21%) | |
| Homeodomain | 150..206 | CDD:459649 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||