DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubx and Hhex

DIOPT Version :10

Sequence 1:NP_536752.1 Gene:Ubx / 42034 FlyBaseID:FBgn0003944 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_032271.1 Gene:Hhex / 15242 MGIID:96086 Length:271 Species:Mus musculus


Alignment Length:75 Identity:31/75 - (41%)
Similarity:46/75 - (61%) Gaps:4/75 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   295 RRRGRQTYTRYQTLELEKEFHTNHYLTRRRRIEMAHALCLTERQIKIWFQNRRMKLKKEIQAIKE 359
            |:.|:..::..||:||||:|.|..||:...|..:|..|.|:|||:|.||||||.|.::    :|:
Mouse   138 RKGGQVRFSNDQTVELEKKFETQKYLSPPERKRLAKMLQLSERQVKTWFQNRRAKWRR----LKQ 198

  Fly   360 LNEQEKQAQA 369
            .|.|..:..|
Mouse   199 ENPQSNKKDA 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UbxNP_536752.1 Homeodomain 296..352 CDD:459649 26/55 (47%)
HhexNP_032271.1 Interaction with SOX13. /evidence=ECO:0000250|UniProtKB:Q03014 1..138 31/75 (41%)
Required for WNT signaling induction. /evidence=ECO:0000250|UniProtKB:Q03014 138..271 31/75 (41%)
Homeodomain 143..195 CDD:459649 25/51 (49%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 195..271 4/18 (22%)

Return to query results.
Submit another query.