DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubx and gbx1

DIOPT Version :9

Sequence 1:NP_536752.1 Gene:Ubx / 42034 FlyBaseID:FBgn0003944 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_777286.1 Gene:gbx1 / 142985 ZFINID:ZDB-GENE-020117-2 Length:316 Species:Danio rerio


Alignment Length:168 Identity:57/168 - (33%)
Similarity:77/168 - (45%) Gaps:32/168 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   205 VAGAGTAWNANCTISGAAAQTAAASSLHQAS----NHTFYPWMAIAGECPEDPTKSKIRSDLTQY 265
            |||....::::.......|..||.|....:|    |.:|    :....|.....|.|::      
Zfish   144 VAGETKLYSSDDEKLDLKAAEAACSDREDSSADSENESF----SDGNTCASASQKGKLK------ 198

  Fly   266 GGISTDMGKRYSESLAGSLLPDWLGTNGLRRRGRQTYTRYQTLELEKEFHTNHYLTRRRRIEMAH 330
            || |.|           :|.|.  |:.|..||.|..:|..|.||||||||...||:...|.::||
Zfish   199 GG-SQD-----------ALPPG--GSAGKSRRRRTAFTSEQLLELEKEFHCKKYLSLTERSQIAH 249

  Fly   331 ALCLTERQIKIWFQNRRMKLKKEIQAIKELNEQEKQAQ 368
            ||.|:|.|:||||||||.|.|:    ||..|...:..:
Zfish   250 ALKLSEVQVKIWFQNRRAKWKR----IKAGNVNNRSGE 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UbxNP_536752.1 Homeobox 299..352 CDD:395001 30/52 (58%)
gbx1NP_777286.1 Homeobox 217..270 CDD:278475 30/52 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.