DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubx and Gbx2

DIOPT Version :9

Sequence 1:NP_536752.1 Gene:Ubx / 42034 FlyBaseID:FBgn0003944 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_446160.1 Gene:Gbx2 / 114500 RGDID:621866 Length:348 Species:Rattus norvegicus


Alignment Length:121 Identity:46/121 - (38%)
Similarity:58/121 - (47%) Gaps:23/121 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   251 EDPTKSKIRSDLTQYGGISTDMGKRYSESLAGSLLPDWLGTNGLRRRGRQTYTRYQTLELEKEFH 315
            |||  .....:..|.||            .|||..     :.|..||.|..:|..|.||||||||
  Rat   222 EDP--GHALEETPQSGG------------AAGSTT-----STGKNRRRRTAFTSEQLLELEKEFH 267

  Fly   316 TNHYLTRRRRIEMAHALCLTERQIKIWFQNRRMKLKKEIQAIKELNEQEKQAQAQK 371
            ...||:...|.::||||.|:|.|:||||||||.|.|:    :|..|...|..:..:
  Rat   268 CKKYLSLTERSQIAHALKLSEVQVKIWFQNRRAKWKR----VKAGNANSKTGEPSR 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UbxNP_536752.1 Homeobox 299..352 CDD:395001 30/52 (58%)
Gbx2NP_446160.1 Homeobox 250..304 CDD:395001 30/53 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.