DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubx and ATHB54

DIOPT Version :10

Sequence 1:NP_536752.1 Gene:Ubx / 42034 FlyBaseID:FBgn0003944 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_001322131.1 Gene:ATHB54 / 10723019 AraportID:AT1G27045 Length:252 Species:Arabidopsis thaliana


Alignment Length:77 Identity:24/77 - (31%)
Similarity:36/77 - (46%) Gaps:8/77 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   299 RQTYTRYQTLELEKEFHTNHYLTRRRRIEMAHALCLTERQIKIWFQNRRMKLKKEIQAIKELNEQ 363
            ::..|..|...||:.|.....|...|::.:|..|.|...|:.:||||||.:.|     .|:|   
plant    69 KRKLTPIQLRLLEESFEEEKRLEPDRKLWLAEKLGLQPSQVAVWFQNRRARYK-----TKQL--- 125

  Fly   364 EKQAQAQKAAAA 375
            |....:.||:.|
plant   126 EHDCDSLKASYA 137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UbxNP_536752.1 Homeodomain 296..352 CDD:459649 17/52 (33%)
ATHB54NP_001322131.1 HOX 68..121 CDD:197696 17/51 (33%)
HALZ 123..161 CDD:460477 6/18 (33%)

Return to query results.
Submit another query.