DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubx and Hoxa1

DIOPT Version :9

Sequence 1:NP_536752.1 Gene:Ubx / 42034 FlyBaseID:FBgn0003944 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_037207.2 Gene:Hoxa1 / 103690132 RGDID:11414885 Length:334 Species:Rattus norvegicus


Alignment Length:420 Identity:99/420 - (23%)
Similarity:151/420 - (35%) Gaps:148/420 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MNSYFEQ---ASG--------FYGHPH-----QATGMAMGSGGHHDQTASAAAAAYRGFPLSLGM 49
            |||:.|.   .||        .|...|     |:..::..|.|..|:....     ||..::   
  Rat     6 MNSFLEYPILGSGDSGTCSARVYSSDHGITTFQSCAVSANSCGGDDRFLGG-----RGVQIT--- 62

  Fly    50 SPYANHHLQRTTQDSPYDAS-------ITAACNKIYG--DGAGAYKQDCLNIKADAVNGYKDIWN 105
            ||:.:||.....|.:.|..|       ..::|...||  :.:..|....||.:||...||     
  Rat    63 SPHHHHHHHHHPQPATYQTSGNLGVSYSHSSCGPSYGAQNFSAPYGPYGLNQEADVSGGY----- 122

  Fly   106 TGGSNGGGGGGGGGGGGGAGGTGGAGNANGGNAANANGQNNPAGGMPVRPSACTPDSRVGGYLDT 170
                                                              ..|.|....|..   
  Rat   123 --------------------------------------------------PPCAPAVYSGNL--- 134

  Fly   171 SGGSPV----SHRGGSAGGNVSVSGGNGNAGGVQSGVGVAGAGTA---WNANCTISGAAAQTAAA 228
              .||:    .|..|.|||.|      |:...:....|......|   :|.:.:...|:.|.|..
  Rat   135 --SSPMVQHHHHHQGYAGGTV------GSPQYIHHSYGQEHQSLALATYNNSLSPLHASHQEACR 191

  Fly   229 SSLHQASN--HTFYPWMAIAGECPEDPTKSKIRSDLTQYGGISTDMGKRYSESLAGSLLPDWLGT 291
            |...:.|:  .|| .||.:    ..:|.|:   ..:.:||.:..               |:.:.|
  Rat   192 SPASETSSPAQTF-DWMKV----KRNPPKT---GKVGEYGYVGQ---------------PNAVRT 233

  Fly   292 NGLRRRGRQTYTRYQTLELEKEFHTNHYLTRRRRIEMAHALCLTERQIKIWFQNRRMKLKK-EIQ 355
            |         :|..|..|||||||.|.||||.||:|:|.:|.|.|.|:||||||||||.|| |.:
  Rat   234 N---------FTTKQLTELEKEFHFNKYLTRARRVEIAASLQLNETQVKIWFQNRRMKQKKREKE 289

  Fly   356 AIKEL-------NEQEKQAQAQKAAAAAAA 378
            .:..:       ::::.:..::|::::.:|
  Rat   290 GLLPISPATPPGSDEKTEESSEKSSSSPSA 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UbxNP_536752.1 Homeobox 299..352 CDD:395001 32/52 (62%)
Hoxa1NP_037207.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 61..82 6/23 (26%)
Interaction with OGT. /evidence=ECO:0000250|UniProtKB:P09022 74..202 33/193 (17%)
COG5576 175..>285 CDD:227863 49/141 (35%)
Antp-type hexapeptide 203..208 3/5 (60%)
Homeobox 232..284 CDD:278475 34/60 (57%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 280..334 8/40 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.