DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubx and hoxc6

DIOPT Version :9

Sequence 1:NP_536752.1 Gene:Ubx / 42034 FlyBaseID:FBgn0003944 Length:389 Species:Drosophila melanogaster
Sequence 2:XP_004911991.1 Gene:hoxc6 / 101733663 XenbaseID:XB-GENE-478131 Length:242 Species:Xenopus tropicalis


Alignment Length:202 Identity:74/202 - (36%)
Similarity:95/202 - (47%) Gaps:47/202 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   217 TISGAAAQTAAASS----------------LHQASNHTFYPWMAIAGECPEDPTKSKIRSDLTQY 265
            |...|.||....||                .::..::.||....:...|.::......:|.|.| 
 Frog    39 TYGAAVAQNRIYSSPFYTPQDNVVFGSSRGPYEYGSNAFYQDKDMLTSCRQNSMGHNTQSSLAQ- 102

  Fly   266 GGISTDMGKRYSESLAGSL-LPDWL-----------------GTNGLRRRGRQTYTRYQTLELEK 312
             ..|::..:...:...||: :..|:                 |....||||||.|:|||||||||
 Frog   103 -DFSSEQSRGNGQEQKGSIQIYPWMQRMNSHSVCLVSDSLGVGYGADRRRGRQIYSRYQTLELEK 166

  Fly   313 EFHTNHYLTRRRRIEMAHALCLTERQIKIWFQNRRMKLKKEIQAIKELNEQEKQAQAQKAAAAAA 377
            |||.|.|||||||||:|:|||||||||||||||||||.|||......|           :....|
 Frog   167 EFHFNRYLTRRRRIEIANALCLTERQIKIWFQNRRMKWKKESNLTSTL-----------SGGTGA 220

  Fly   378 AAAAVQG 384
            ||.::.|
 Frog   221 AADSLAG 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UbxNP_536752.1 Homeobox 299..352 CDD:395001 45/52 (87%)
hoxc6XP_004911991.1 Homeobox 153..205 CDD:278475 45/51 (88%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.