DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubx and Hoxa4

DIOPT Version :9

Sequence 1:NP_536752.1 Gene:Ubx / 42034 FlyBaseID:FBgn0003944 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_077326.1 Gene:Hoxa4 / 100912525 RGDID:2814 Length:285 Species:Rattus norvegicus


Alignment Length:325 Identity:90/325 - (27%)
Similarity:108/325 - (33%) Gaps:130/325 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 NGGGGGGGGGGGGGAGGT---------------------------------GGAGNANGG----- 136
            :||.|||.||.|||.|..                                 ||...|...     
  Rat    26 HGGPGGGDGGVGGGPGYPRPQSSPHLPAPNPHAARQTPAYYAPRAREPSYHGGLYPAPAAACPYA 90

  Fly   137 --NAANANGQNNPAGGM--------PVRPSACTPDSRVGGYLDTSGGSPVSHRGGSAGGNVSVSG 191
              .|:.|..:.:||.|.        |..|..|.|...          :|....||||.....:..
  Rat    91 CRGASPARPEQSPAPGAHPSPAPQPPAPPRRCAPGPT----------TPAVATGGSAPACPLLLA 145

  Fly   192 GNGNAGGVQSGVGVAGAGTAWNANCTISGAAAQTAAASSLHQASNHTFYPWMAIAGECPEDPTKS 256
            ..|.||                                  .:......||||            .
  Rat   146 DQGPAG----------------------------------PKGKEPVVYPWM------------K 164

  Fly   257 KIRSDLTQYGGISTDMGKRYSESLAGSLLPDWLGTNGLRRRGRQTYTRYQTLELEKEFHTNHYLT 321
            ||.                     ..::.|.:.|  |..:|.|..|||.|.||||||||.|.|||
  Rat   165 KIH---------------------VSAVNPSYNG--GEPKRSRTAYTRQQVLELEKEFHFNRYLT 206

  Fly   322 RRRRIEMAHALCLTERQIKIWFQNRRMKLKKEIQAIKELNEQEKQAQAQKAAAAAAAAAAVQGGH 386
            ||||||:||.|||:|||:||||||||||.||:   .|..|.:.:.:....|.|.....|.....|
  Rat   207 RRRRIEIAHTLCLSERQVKIWFQNRRMKWKKD---HKLPNTKMRSSNPASAPAGPPGKAQTHSPH 268

  Fly   387  386
              Rat   269  268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UbxNP_536752.1 Homeobox 299..352 CDD:395001 41/52 (79%)
Hoxa4NP_077326.1 Homeobox 183..236 CDD:278475 41/52 (79%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.