DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubx and pdx1

DIOPT Version :9

Sequence 1:NP_536752.1 Gene:Ubx / 42034 FlyBaseID:FBgn0003944 Length:389 Species:Drosophila melanogaster
Sequence 2:XP_002934065.1 Gene:pdx1 / 100490648 XenbaseID:XB-GENE-483331 Length:271 Species:Xenopus tropicalis


Alignment Length:160 Identity:55/160 - (34%)
Similarity:71/160 - (44%) Gaps:48/160 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   229 SSLHQASNHTF--YPWMAIAGECPEDPTKSKIRSDLTQYGGISTDMGKRYSESLAGSLLPDWLGT 291
            |:..:..|.|.  :|||        ..|||.     |..|                    .|.|.
 Frog   107 SATLEERNRTLLPFPWM--------KSTKSH-----TWKG--------------------QWTGG 138

  Fly   292 NGL-----RRRGRQTYTRYQTLELEKEFHTNHYLTRRRRIEMAHALCLTERQIKIWFQNRRMKLK 351
            :.:     .:|.|..|||.|.|||||||..|.|::|.||:|:|..|.||||.|||||||||||.|
 Frog   139 SYIMEQEENKRTRTAYTRAQLLELEKEFLFNKYISRPRRVELAVMLNLTERHIKIWFQNRRMKWK 203

  Fly   352 KEIQAIKELNEQEKQAQAQKAAAAAAAAAA 381
            ||        |.:|:.:.......:..::|
 Frog   204 KE--------EDKKRGRGSDPEQDSVVSSA 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UbxNP_536752.1 Homeobox 299..352 CDD:395001 35/52 (67%)
pdx1XP_002934065.1 Homeobox 150..204 CDD:365835 35/53 (66%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.