DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubx and hoxa6

DIOPT Version :9

Sequence 1:NP_536752.1 Gene:Ubx / 42034 FlyBaseID:FBgn0003944 Length:389 Species:Drosophila melanogaster
Sequence 2:XP_002933441.2 Gene:hoxa6 / 100485428 XenbaseID:XB-GENE-481964 Length:237 Species:Xenopus tropicalis


Alignment Length:273 Identity:87/273 - (31%)
Similarity:114/273 - (41%) Gaps:103/273 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   142 NGQNNPAGGMPVRPSACTPDSRVGGYLDTSGGSPVSHRGGSAGG----------------NVSVS 190
            |||....|.:|               |.:||...:.|..|:.|.                :.::.
 Frog    16 NGQEAFVGQIP---------------LYSSGYEALRHFPGAYGSPPVQDKPYPSPCFYQQSNTLI 65

  Fly   191 GGNGNAGGVQSGVGVAGAGTAWNANCTISGAAAQTAAASSLHQASNHTFYPWMAIAGECPEDPTK 255
            ..|||:             ..:.|:|..||..:..:.:|                        ..
 Frog    66 ACNGNS-------------YEYGASCFYSGKESSGSPSS------------------------YG 93

  Fly   256 SKIRSDLTQYGGISTDMGKRYSESLAGSLLPD-------------WL-----------GTNGLRR 296
            :|.|.|..:|...|.|..:..|.|..|.:|.:             |:           |.:|  |
 Frog    94 TKHRGDSGEYLHFSADQQQYKSASAQGKMLHEEPTDRKYSSPVYPWMQRVNSCTGPVYGAHG--R 156

  Fly   297 RGRQTYTRYQTLELEKEFHTNHYLTRRRRIEMAHALCLTERQIKIWFQNRRMKLKKEIQAI---- 357
            ||||||||:||||||||||.|.|||||||||:|:|||||||||||||||||||.|||.:.:    
 Frog   157 RGRQTYTRFQTLELEKEFHFNRYLTRRRRIEIANALCLTERQIKIWFQNRRMKWKKESKLLLPSH 221

  Fly   358 -----KELNEQEK 365
                 .|..::||
 Frog   222 PSDDPSEGKQEEK 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UbxNP_536752.1 Homeobox 299..352 CDD:395001 46/52 (88%)
hoxa6XP_002933441.2 Homeobox 159..212 CDD:365835 46/52 (88%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.